(data stored in SCRATCH zone)

EMBL: CP000272.PE336

CP000272.PE336       Location/Qualifiers
FT   CDS_pept        complement(381055..382215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0352"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36264"
FT                   /db_xref="GOA:Q13I25"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I25"
FT                   /protein_id="ABE36264.1"
FT                   /translation="MLSKLQNEPAVAGVGTTRYGKLPGHDIYELAQWALREALDDCGLT
FT                   HADLDGLIVNRIPSYSHFADQCGMNPQYVLATPGHGRFSGICIQTAALLVSSGAVNTVA
FT                   LVYANDGGSAGITYGGDASQFGGAAGAYGGADSHWVPYGMTSPGAFHALMMQRHMHLHG
FT                   TTASQLAEVAMTFRHHASLNPAAVKRDPFTLEQYLESRFICDPLRLLDYCLINDGAVAM
FT                   IITNGSRARDLRKPPVYIRGVGQASQFTGGGFPPDDFWARPMRQVAQEVHSMAGTTVND
FT                   MDGLMIYDNFTPTVLFSLEGFGFCPTGESGRWVSEGHLRLGGRFPANTSGGHLSESYLQ
FT                   GWGLNAEAVRQLRGECDARQIAGADFIQYMAASPVVTSIIYGKDPK"
     atgttgtcaa aacttcaaaa cgagcctgcc gtggccggcg tgggcaccac gcgttatgga        60
     aagctacccg ggcacgatat ctatgaactg gcccaatggg ctctgcgcga ggcgctcgat       120
     gactgtgggc tgactcatgc ggacctcgat gggctgatcg tcaaccggat cccgagttac       180
     agtcacttcg ccgaccagtg cggcatgaat ccgcaatacg tgctggcgac accgggacat       240
     ggccgcttca gcggcatctg catccagacg gccgctctgc tggtctcgag cggcgcggtc       300
     aataccgtgg cgctcgtcta cgccaacgac ggcggtagcg ccggcatcac gtatggcggc       360
     gacgccagcc agttcggcgg agcggccggc gcctatgggg gcgccgacag tcactgggtg       420
     ccctacggca tgacttcgcc gggtgcgttt catgcattga tgatgcaacg gcatatgcat       480
     ctccatggaa ccacggcctc gcagcttgcc gaagtggcga tgacgttccg ccaccacgcg       540
     agcctgaatc ccgctgccgt gaagcgcgac ccgttcacgc tcgaacagta cctcgaaagc       600
     cgctttatct gtgacccgct ccggctgctc gactactgcc tgatcaatga cggggccgtc       660
     gccatgatta tcacgaatgg atcgcgggca cgcgacttgc gcaaaccgcc ggtctatatt       720
     cgcggcgtcg gccaggcgtc gcagttcacc ggtggcggct ttcctcccga tgatttctgg       780
     gcccggccga tgcgtcaggt tgcgcaggaa gttcactcga tggccgggac gacggtcaac       840
     gacatggacg ggctgatgat ctacgacaac ttcacgccga cggtgctgtt ttcgctggaa       900
     gggttcggct tctgcccgac cggcgagagt ggccgctggg tcagtgaagg tcacctgcgc       960
     ctcggcggcc ggttcccggc caataccagc ggcggtcacc tctccgagtc ttatctgcag      1020
     ggatggggcc ttaatgccga agccgtcagg caactacggg gggaatgtga cgcgaggcag      1080
     atcgccggcg ccgacttcat acagtatatg gcggcgtccc ccgtggtcac gtcgatcatc      1140
     tacggaaagg atccgaaatg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page