(data stored in ACNUC7421 zone)

EMBL: CP000272.PE337

CP000272.PE337       Location/Qualifiers
FT   CDS_pept        complement(382244..383131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0353"
FT                   /product="Putative senescence marker protein-30 (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36265"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I24"
FT                   /protein_id="ABE36265.1"
FT                   /translation="MSLMQTTPTLACAVDCHNVLGESPIWSPLEQALWWIDVANPTLWR
FT                   HDPASGALDQWSLPRPPAVIALRRNGGLLLLFRRGYLLLDRPAPGDIIAEPVPFALDAD
FT                   RLNDGKVDQAGRMWVGSLARDLVSPVGQLYRFGTDRALHPVDRGFTLSNGIGWSPMQTT
FT                   MYFADTHSKTVHAYDFECTSGTLANRREFIRISGHGGPDGLTVDANGNVWVAVFGAGAV
FT                   HCYRPDGVLARAIELPTAFPTSCTFGGPGLDTLYVTSASMNLDGEAVSGTASTGAVWAV
FT                   EAVGPGQPESLLDY"
     gtgtcactca tgcaaaccac tcccacgttg gcgtgcgccg tggactgtca caacgtattg        60
     ggcgaaagcc cgatctggag tccgctggag caggcgctct ggtggatcga tgtcgccaac       120
     cccacactct ggcggcacga tcccgcgagc ggtgctctcg accaatggtc gttgccccga       180
     cctccagcgg tcatcgcctt gcggcgcaac ggcggcctgc tgctgctgtt ccggcgaggc       240
     tatctgctgc tcgaccgtcc ggcaccgggc gacatcattg ccgaacccgt tccgttcgca       300
     ctcgatgccg accgccttaa cgacggcaag gtcgatcagg caggcaggat gtgggtaggc       360
     agccttgccc gggacctcgt gtcgccagtt ggccagttat accggttcgg cacggaccgg       420
     gcgttacacc cggtcgatcg cggcttcacg ctatcgaacg ggattggctg gagtccgatg       480
     cagaccacca tgtactttgc cgatacgcat tcaaaaacgg tccacgcgta tgacttcgaa       540
     tgcacgagcg gaacactcgc caatcggcgg gaattcatca ggatctctgg ccatggagga       600
     cccgacggac tgacggtcga tgcgaacgga aacgtgtggg ttgccgtttt cggcgccggc       660
     gccgtgcatt gctaccgccc cgacggcgta ctcgcccgtg cgatcgaact gccgaccgcc       720
     ttcccgacaa gttgcacgtt cggcggacct ggcctcgaca cgctttatgt cacgtcggcc       780
     tcgatgaacc tcgatggaga agcggtgtcc gggacggcca gcacgggagc ggtctgggca       840
     gtcgaggcgg tcggtcccgg gcagcccgaa tcactgctcg actattaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page