(data stored in ACNUC7421 zone)

EMBL: CP000272.PE341

CP000272.PE341       Location/Qualifiers
FT   CDS_pept        389745..390236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0361"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36269"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I20"
FT                   /protein_id="ABE36269.1"
FT                   /translation="MVRRRQPKTGFMSSLPMTQRPSHEDEGQFALWRSKCPASAVDSLS
FT                   VVVAHTEIPVGESIALLLRLRGFAAVAMSSMENLELMLEHWKPRALLIDTRLCQADDFR
FT                   LVRHAASDTAFSSVLIVALTNIFPEESPQDIKRIGFDGLCRRPCPVWRLADVLDGHFHP
FT                   "
     gtggttcgtc gcaggcagcc caaaacggga ttcatgtcct ctctgccaat gacccagcgc        60
     ccatcgcacg aagacgaggg acagttcgcg ctgtggcgct cgaagtgtcc agccagcgct       120
     gtcgattccc taagcgtagt cgtagcccat acggaaattc cggtaggaga gtcgatagcg       180
     ttgctgctga gattgcgagg tttcgctgcc gtagccatgt cgagtatgga aaacctggag       240
     ctgatgcttg agcattggaa gccgcgcgcg ttgctgatcg acacgcgcct gtgtcaggcg       300
     gatgacttcc ggctcgtccg ccatgcagct agcgacactg cctttagtag tgttctgatt       360
     gtcgcgctga ctaacatttt ccccgaagag agcccgcaag acatcaagcg gattggcttt       420
     gatggcctat gtcgcaggcc atgcccggtg tggagacttg cggatgtgct tgacgggcat       480
     tttcacccat ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page