(data stored in ACNUC7421 zone)

EMBL: CP000272.PE354

CP000272.PE354       Location/Qualifiers
FT   CDS_pept        400626..401168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0375"
FT                   /product="Periplasmic protein thiol-disulfide
FT                   oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36282"
FT                   /db_xref="GOA:Q13I07"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I07"
FT                   /protein_id="ABE36282.1"
FT                   /translation="MKRVFVPLIGFAVLVAVLAAGLRHDPRRLPSALIGQPAPSFDLPG
FT                   LGATDKRVSPQVLRGQVWILNVWASWCESCRDEHPLLVDLAARRIAPVYGMDYKDERAP
FT                   ALQWLAEAGDPYTASFVDHSGQTGIDYGVYGVPETFVIDRAGIIRYRHAGPLTRQSLDG
FT                   VILPLVRQLQHEDINGS"
     atgaaacgcg tgttcgttcc gcttatcggt tttgcggtgc tggtggcagt gctggcagcc        60
     gggctcaggc acgatccgcg ccgcttgccg tccgcgctga tcggtcagcc ggcgccgtca       120
     ttcgatctcc ccggcttggg ggctacggac aagcgggtgt cgccgcaagt gctgcgcggg       180
     caggtgtgga ttctgaacgt gtgggcgtcg tggtgcgaat cgtgccggga cgaacacccg       240
     ttgctggtcg atctggccgc gcgccggatc gcgccagtct acggcatgga ctacaaggat       300
     gagcgcgcgc ccgcgctgca gtggcttgcc gaggcaggcg atccctatac ggcttcgttc       360
     gtcgatcaca gtggccagac cggtatcgac tacggcgtgt acggtgtgcc cgagactttc       420
     gtgatcgacc gcgcaggaat catacgctac cggcacgcgg gaccgttgac gcgtcagtcg       480
     ctcgacggcg ttatcctgcc gctcgtcagg caattgcagc atgaggacat aaatggttcg       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page