(data stored in ACNUC7421 zone)

EMBL: CP000272.PE355

CP000272.PE355       Location/Qualifiers
FT   CDS_pept        401158..401652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0376"
FT                   /product="Putative cytochrome C biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36283"
FT                   /db_xref="GOA:Q13I06"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I06"
FT                   /protein_id="ABE36283.1"
FT                   /translation="MVRDPNGWPMRWTAVVLLLVTLNCAAWGAAGSSTDDSHYQARVRQ
FT                   LAEGFRCLVCQNQSLADSNADLAADLRAKIGEEVRQGATDAQVRAYMVHRYGDFVLYRP
FT                   PVKPATWALWFGPFVALMVGVSVLWRTMLRRRNVQPRLLDEDERRRVNEWLPAQDESPL
FT                   R"
     atggttcgtg atccgaatgg atggccaatg cgttggacag cggttgtgct gcttctggtc        60
     acactgaact gtgctgcgtg gggagccgcc gggtcgtcca cggacgattc ccactatcag       120
     gcccgcgtgc gccaacttgc cgaaggcttt cggtgcctcg tgtgccagaa ccagagcctc       180
     gcagactcca atgccgatct cgcagccgat ttgcgtgcga agatcggcga ggaggttcgg       240
     caaggcgcga ccgacgctca ggtgcgggct tacatggtgc accgatacgg agatttcgtg       300
     ctgtaccggc caccagtgaa acccgcaacg tgggcgctgt ggtttggacc tttcgttgcg       360
     ttgatggtgg gggtgagcgt gctctggcga accatgctgc gccgtcgcaa cgtgcagccg       420
     cgcctgctgg acgaggatga gcgccggcgt gtcaatgagt ggctcccggc ccaggatgag       480
     agcccgctgc gatga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page