(data stored in ACNUC7421 zone)

EMBL: CP000272.PE359

CP000272.PE359       Location/Qualifiers
FT   CDS_pept        complement(403502..403744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36287"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I02"
FT                   /protein_id="ABE36287.1"
FT                   /translation="MVLARAESALAETVQQVATVSEMATSIHRCHQYDDAMPPSANSFT
FT                   YESTANYTFRLTWKVISGDSMPALIQVTVRVLQRR"
     gtggttcttg cgcgggcaga atcggctctc gcggaaacgg tacagcaagt tgccacggtt        60
     tcagaaatgg ccacatcgat acaccggtgc catcaatatg atgatgctat gccgccctca       120
     gcgaattcgt tcacttatga gagcactgca aactacacat tccgattgac atggaaagtc       180
     atatcgggtg attcgatgcc tgccctcatt caagtgactg tgcgtgtgct gcagcgccgg       240
     tag                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page