(data stored in ACNUC7421 zone)

EMBL: CP000272.PE360

CP000272.PE360       Location/Qualifiers
FT   CDS_pept        404182..404877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0381"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36288"
FT                   /db_xref="GOA:Q13I01"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I01"
FT                   /protein_id="ABE36288.1"
FT                   /translation="MSTEVISRSGRLAGRPPRYGNRQRNPVRRYAGIAVVVLLHILFIW
FT                   ALMNGLANKVVQIVQKPIETKIIEPVKPPPPPPMPTVQLPPPKFTPPPPPFVPPPEVAV
FT                   TPPPARAPTITHQAVPIPTPVAPPPPAPVAPPAPAKPVSHAVGVVCPNSDEVRRSVGYP
FT                   QEAQDNDISGDVMISFVVDPQGHVTDEKVEQSADPILDRAAFSAVKKFNCISQGQPVRV
FT                   QVPFSFKLN"
     atgtccacag aggtgatttc cagatcgggc cggttagcgg ggcgcccacc ccggtatggg        60
     aatcgccagc ggaatccggt acgccgttac gccggtattg ctgtcgtcgt gctcctgcac       120
     atcctgttca tctgggcgtt gatgaatggt cttgcgaaca aggtcgtgca gatcgtgcag       180
     aagccgatcg agacgaagat catcgagccg gtgaagccac ctcccccgcc gccgatgccg       240
     acggtgcaac tgccgccgcc gaagttcacg ccgccaccgc cgccgttcgt gccgccgcct       300
     gaagtggcgg tcacgccgcc gccagcacgc gcgccgacca tcacccacca ggccgtgccg       360
     ataccgacgc cggtcgcgcc gccaccgcct gcgccggtcg cgccgccggc tcctgcgaag       420
     ccggtcagtc acgcggtggg cgtggtgtgc ccgaactcgg acgaggtccg gcgctcggta       480
     ggctatccgc aggaagcgca ggataacgac atcagcggcg acgtcatgat ctcgtttgtc       540
     gtcgacccgc agggtcatgt gaccgacgag aaagtcgagc agtccgctga cccgattctc       600
     gaccgggcag ctttcagcgc ggtgaagaag ttcaactgta tttcgcaagg gcagccggtc       660
     cgcgtacagg tgccgttctc gttcaagctg aactga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page