(data stored in ACNUC7421 zone)

EMBL: CP000272.PE362

CP000272.PE362       Location/Qualifiers
FT   CDS_pept        405912..406337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0383"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36290"
FT                   /db_xref="GOA:Q13HZ9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ9"
FT                   /protein_id="ABE36290.1"
FT                   /translation="MAMNVGQDGDEDEVIASINTTPLVDVMLVLLIIFLITIPVVTHTV
FT                   PVQLPAQTVNPLQTRPDSIEIAVNKDGYFFWNEKLVDAPTLLARLKVASVKLPQPEVHV
FT                   RGDRATRYEFIGRVITACERAGIAKVSFITQPPARGG"
     atggccatga acgttggaca ggacggtgac gaggacgaag tcatcgcttc catcaacacg        60
     acgccgctcg tcgacgtgat gctggtgttg ctgatcatct tcctgatcac gatcccggtc       120
     gtcacgcaca cggtgccggt gcagttgccg gctcagacgg tgaatccgct gcagaccagg       180
     ccggacagca ttgagatcgc agtcaacaag gacggttact tcttctggaa cgagaagctg       240
     gttgacgcgc cgacgctact cgcgcggctg aaggtggcgt cggtgaagct gccacaaccc       300
     gaggtgcatg tacgcggtga ccgggcgaca cgctacgaat tcatcgggcg cgtaattacc       360
     gcgtgcgagc gtgccgggat agcaaaggtt tcatttatta ctcagccgcc agcgcgcggc       420
     ggctag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page