(data stored in ACNUC7421 zone)

EMBL: CP000272.PE364

CP000272.PE364       Location/Qualifiers
FT   CDS_pept        406836..408044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36292"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ7"
FT                   /protein_id="ABE36292.1"
FT                   /translation="MMLRSVRRTAAVAALNGLLALAGWPVVSHSADTLRPEVARPLNDA
FT                   QNLYRARNYRGALSKVSLAAAVPGKTAYETRVIGEMQGAAAIAAGDTGVAAGAYEALLS
FT                   SGALDGASTQQYSAALAGIYFQQKNYAAAIRTAQRYQKAGGTDPQMRELLLQSYFLSGD
FT                   CGNVVAALKPGIDAALKGGRAPVESQLQMLAQCAQKTKDDSAHADALAALVAYYPKPAY
FT                   QEQLFNTVRGKPGYFASLDLDIYRLRRATGTLTTAEQYMEMTQLALVAGIPAEAKQVID
FT                   QGFASGVLGHDAQAGREKRLQALVIRRLQGQSDPNNLPVDPVDGALNLVFAGQVQQGIG
FT                   AGAAAVGKDAAHQDAARLRLGEAYYYAGQKAHAAQVFGTVKGADGSADLARLWALVADR
FT                   RSE"
     atgatgctac gtagcgtgag acgtaccgca gcagtggcgg cgcttaatgg cttacttgcg        60
     ctggcggggt ggcccgtcgt ctctcattcg gccgacacgc tgcgtcctga agtggcgagg       120
     ccgttgaacg acgcgcagaa cctgtaccgc gcgcgcaact atcgcggtgc gctcagcaag       180
     gtttcgctgg ctgcggcggt gccgggcaag acggcgtacg aaacgcgcgt gatcggggag       240
     atgcagggtg cggccgcgat cgcggccggc gacaccggtg tcgctgccgg ggcttatgag       300
     gcgctgctgt cgtcgggcgc acttgacggc gcgagcacgc agcagtactc ggcggcgctc       360
     gcaggcatct acttccagca gaagaattat gcagcggcga tccgcaccgc acagcgttac       420
     cagaaggcgg gtggcactga cccgcaaatg cgcgaactgc tgctgcagtc gtattttctg       480
     tctggcgact gcgggaatgt cgtcgcggcg ctcaagccgg gcatcgacgc cgcgttgaag       540
     ggcggccgtg cgcccgtcga gtcgcagttg cagatgctcg cgcagtgcgc gcagaaaaca       600
     aaagatgaca gcgcgcatgc tgacgccctg gcggcgcttg ttgcgtacta cccgaagccg       660
     gcgtaccagg agcagttatt caataccgtg cgcggcaagc ccggttactt cgcgtcgctc       720
     gacctcgaca tctatcgttt gcggcgcgcg accggtacgc tgacgacagc cgagcagtac       780
     atggagatga cccagctcgc gctcgtggcc gggatacccg ctgaggccaa gcaggtgatc       840
     gaccagggct tcgcgtcggg cgtgctggga cacgacgcgc aggccggacg tgagaagcgt       900
     ctgcaggcgc ttgtcatccg gcgtttgcag gggcagagcg accccaacaa cttgccggta       960
     gatccagtag atggcgcgtt gaacctcgtg tttgcgggac aggtgcagca ggggattggt      1020
     gcgggcgccg ccgcggtcgg caaggacgct gcgcatcagg atgcggcacg cctgcgtctg      1080
     ggcgaagcgt attactacgc gggacagaag gcgcacgcgg cgcaggtgtt cggtaccgtg      1140
     aagggtgccg acggctcggc cgaccttgcg cgcctgtggg cgctggtcgc cgatagacgg      1200
     agtgagtag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page