(data stored in ACNUC7421 zone)

EMBL: CP000272.PE382

CP000272.PE382       Location/Qualifiers
FT   CDS_pept        complement(430290..430913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0405"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36310"
FT                   /db_xref="GOA:Q13HX9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX9"
FT                   /protein_id="ABE36310.1"
FT                   /translation="MWFDLSQLSPRDGYKLLSSTIVPRPIAWVVSADANGRLNAAPFSF
FT                   FNLFSDDPPVICLGIMGRAGQQKDTGANIRARGEFVVNLVPERLAHQMNATACEYEHGV
FT                   DELQAADLATAPCPTIAIPRIAESPVALECIPMRYIELGNGRMLIAATVRSVYIDDAAV
FT                   LDRDNCYVDTPALGLVARMHGRGEYARTSNLFTMPRPPTPPASS"
     atgtggttcg acctgagcca gctatcgccg cgcgacggct acaagctgct atcttcaacc        60
     atcgtaccgc gtccgattgc atgggtggtc agcgccgatg ccaacggccg cctcaacgcc       120
     gcgcctttct cgttcttcaa cctgttcagc gacgacccgc ccgtgatctg tcttggcatc       180
     atgggacgcg cgggacagca gaaggacact ggagcaaaca tccgcgcacg tggcgaattc       240
     gtcgtaaacc tcgtacccga acggctggct caccagatga acgcaaccgc gtgcgaatac       300
     gagcacgggg tcgacgaact gcaagcagca gatctcgcca ccgcgccgtg cccgacgatc       360
     gcgattccgc gcattgccga aagccccgtc gcgctcgaat gcattccgat gcggtacatc       420
     gaactcggca acgggcggat gctgattgcg gccaccgtcc gctccgtcta catcgacgat       480
     gcagccgtgc tcgaccggga caactgctat gtcgacacgc ccgcgctcgg cctcgtcgcg       540
     cggatgcacg ggcggggcga atatgcacgt acgtcgaacc tcttcacgat gccgcgtccg       600
     ccgacaccgc cggcttcttc ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page