(data stored in ACNUC7421 zone)

EMBL: CP000272.PE387

CP000272.PE387       Location/Qualifiers
FT   CDS_pept        436507..436812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36315"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX4"
FT                   /protein_id="ABE36315.1"
FT                   /translation="MVQTGHGALKRHACVCGLSLRHVWNAAACLPWDESASERYSGTAG
FT                   NSEVFFSNRSPEQEPFVRSRLMGTAGKRWDVGGERVTQDFRNDSPDRMFDAFAGAG"
     gtggtgcaga ctggtcacgg agctttgaag cggcatgcct gcgtgtgcgg tctgtcgctc        60
     aggcatgtat ggaacgcggc tgcgtgcctc ccatgggacg aatctgcttc tgaaaggtac       120
     agcggtactg ccggaaatag cgaagttttt ttctctaatc ggtcgcctga gcaagaaccg       180
     ttcgttcggt cacgattgat gggaaccgct gggaaacgat gggatgtcgg cggcgagcgg       240
     gtcactcagg atttcaggaa tgattctcct gaccggatgt ttgatgcatt cgctggtgca       300
     ggctag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page