(data stored in ACNUC7421 zone)

EMBL: CP000272.PE391

CP000272.PE391       Location/Qualifiers
FT   CDS_pept        complement(438475..439224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0415"
FT                   /product="Putative autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36319"
FT                   /db_xref="GOA:Q13HX0"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX0"
FT                   /protein_id="ABE36319.1"
FT                   /translation="MSFVVAGRLDDLPSHIRHDLGTFRHQVFIQRLHWEIPGVPRDAIS
FT                   EWDEFDGGSTVHLVALSANDRVCGCARLMPTTGPYLLRDVFPELTGAGSPPSSPSVWEM
FT                   SRFAGSGLTDHRTGSASGMSLFPYAMSLARSFGATRLIGVVTRPVARLYRRFGLDLRHI
FT                   GASSSPGHADIVACAIDLTTATFDKLQCDADSLLRSISCLGHLPRPQQSLCAPLKAKEE
FT                   GLHSAVSRDETSFPACGSGTARTERAI"
     atgtcattcg tcgttgccgg caggctcgat gacctgccat cacatatccg tcacgatctt        60
     ggaaccttcc gccatcaggt gtttatccag cgcctgcact gggaaatacc gggcgtaccg       120
     cgcgatgcca tcagcgaatg ggatgaattc gatggaggca gtaccgtcca tctggttgcc       180
     ctgtcggcga acgacagggt ctgtggatgc gctcgcctga tgcctaccac aggaccctat       240
     ctgctccgtg atgtcttccc ggaactcact ggcgcgggtt ccccaccttc atcaccgtcg       300
     gtatgggaaa tgtcacgatt cgccggatcg gggctgaccg accatcgcac cggctccgcc       360
     tcaggcatgt cgttgttccc ttacgcaatg tcgctcgcgc ggtccttcgg cgcgacacgg       420
     ttgatcggcg tcgtcacgcg ccctgttgcg cgtctgtatc gccggttcgg gctcgacctc       480
     cgccatatcg gtgctagctc gtcgcccggg cacgccgaca tcgttgcgtg tgcaatcgac       540
     ctcacgaccg ccaccttcga taaacttcaa tgcgatgccg acagtctgct gagatcgatc       600
     tcatgcctgg gacatctccc gcggccccag cagagcttgt gcgctccttt gaaggcgaaa       660
     gaagagggac tacattctgc tgtctccagg gacgagacga gtttcccggc ttgcggcagc       720
     ggaacagccc gcacggaacg ggcaatttaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page