(data stored in ACNUC7421 zone)

EMBL: CP000272.PE393

CP000272.PE393       Location/Qualifiers
FT   CDS_pept        complement(440497..441423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0417"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36321"
FT                   /db_xref="GOA:Q13HW8"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW8"
FT                   /protein_id="ABE36321.1"
FT                   /translation="MIPDLGIPHVAFHLPQRVDDVRGWGKRTRQTIATVQNLERAGMRY
FT                   YRNANGQTAIGLAASAIQRLLVASGIAPPEVDCIVYVHTLQGSIAPPPQSLPGLLCDRF
FT                   GFTNAEAFSFAQQHCASALGALRVIRAMFIARPHMKRVLLVGADVMPLDSERLMKAEGI
FT                   LGDGAFAAFIERDAAVNRLLAIATHASGLGWRGVLSKDEQRLAAQYFLAARGLITQTIQ
FT                   QAHCTLNDIQRILPHHLDLPAWHRLLDSLHFPRERLFEKNFARIGHVTVSDAFINLADC
FT                   DGLIPGRPFLLFARGVGGFSAAALLVR"
     atgatccccg atctcggcat accgcacgtc gcctttcatc tcccccagcg tgtcgacgac        60
     gtccggggct ggggaaagag gacccggcag acgatcgcca ccgtgcagaa cctggagcgg       120
     gccgggatgc gttactaccg caatgcgaat ggacagaccg caattggact tgcggccagc       180
     gcgatccagc gtcttctggt cgcctccggt atcgcacctc ctgaagtcga ctgcatcgtc       240
     tacgtgcata cgctccaggg cagcatcgcg ccaccaccgc agtcgctgcc cggcctgctc       300
     tgtgaccggt ttggcttcac caacgcggaa gctttctcgt tcgcgcagca gcattgtgca       360
     tccgcccttg gcgcgctgcg cgtgattcgc gcgatgttca ttgcccggcc ccacatgaaa       420
     cgggtcctgc tcgtcggcgc cgacgtaatg ccgctcgatt cagaaaggtt gatgaaagca       480
     gaggggattc tgggtgatgg agcgtttgct gcattcatcg agcgcgatgc cgctgtcaac       540
     cgcctgctcg caatcgcgac gcatgccagc ggcctgggct ggcgtggagt actgtccaaa       600
     gacgaacagc gcctcgcagc gcaatatttc ctcgctgcac gtggtctgat cacgcagaca       660
     atccagcagg cgcactgcac actgaacgat atccagcgca tcctgcctca ccatctcgat       720
     ctacccgcat ggcaccgcct gctcgactct cttcacttcc cgcgggagcg gttgttcgag       780
     aagaattttg cgcgaatcgg ccacgtcacc gtcagcgatg ccttcatcaa tctggccgac       840
     tgcgacggac tgattcctgg caggccgttt ctgctttttg cacgcggcgt aggcgggttt       900
     tcagcagcag cgctgctggt ccgttag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page