(data stored in ACNUC7421 zone)

EMBL: CP000272.PE399

CP000272.PE399       Location/Qualifiers
FT   CDS_pept        complement(447063..448010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0423"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36327"
FT                   /db_xref="GOA:Q13HW2"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW2"
FT                   /protein_id="ABE36327.1"
FT                   /translation="MSATPLPSVLSLSGVASSLPVRTVDANIWARRCGFPEARANALLK
FT                   NGVQQFHDATATSPVAFACEAVSALLEDTGTTPASIDALIYTHTIQSNVLAPPAGTAAF
FT                   IQSRLGLERALAFSVMQQNCVSPMAAVHLLRMLTVAGRPIQRAIVVCADVMGSGCDHLR
FT                   AIQDLALHSDGACALLLERCVDRNCIVGLHLYTDARYFRGTDDDLQPVPDDRYYWSAFT
FT                   TMRAALGQAGITGSQLVRVLPHHVNLPGWSRLMTMLSAPQERLFTAGFGRLGHVFGADP
FT                   FINFHTAPRGEPGSHSLLFSSGLAGCFGAMVIRH"
     atgtctgcaa cgccactccc ttctgtgctg tcgctgtccg gcgtcgcatc cagcctgccg        60
     gtacgaacag tcgatgcgaa catctgggcc cgtcgctgcg gatttcccga ggcgcgcgca       120
     aatgcgctgc tgaagaatgg tgtgcagcag ttccacgatg ctacagcgac atcccccgtc       180
     gcattcgcgt gcgaagcggt atccgccctg ctcgaggaca ccggcacgac gccagcaagc       240
     atcgatgccc tcatctacac ccacacaatc cagagcaatg tcctggcacc gcccgccggc       300
     actgcggcgt tcatccagtc ccgcctgggc ctggagcgcg ccctcgcgtt ctcggtgatg       360
     cagcagaact gcgtgtcgcc gatggccgcc gtccacctgc tgcgcatgct caccgtcgcg       420
     ggtcgtccca tccagcgggc gatcgttgtc tgcgcggacg tgatgggctc gggctgcgat       480
     catctgcgcg ccatccagga cctcgcgcta cacagcgacg gcgcatgtgc gctcctgctg       540
     gagcgctgtg tcgatcgcaa ctgcatcgtg gggttgcacc tttatacgga cgctcgctac       600
     ttccgcggca ccgacgatga ccttcagccc gtgccggatg atcgttacta ctggtcagca       660
     tttacgacga tgcgtgcggc actgggacag gcaggcatca cgggaagcca gctcgtccgt       720
     gtcctgcctc accacgtcaa cctgcccggc tggtcgcgcc tcatgaccat gctgtccgcg       780
     cctcaggagc gtcttttcac cgcgggtttc ggacgcctcg gccacgtgtt cggcgccgac       840
     ccgttcatca atttccacac cgcgccacgc ggggaaccgg gctcgcactc cctgctgttt       900
     tccagcggac ttgccggctg ctttggcgcg atggtgatcc gccactga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page