(data stored in ACNUC7421 zone)

EMBL: CP000272.PE400

CP000272.PE400       Location/Qualifiers
FT   CDS_pept        complement(448013..449047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0424"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36328"
FT                   /db_xref="GOA:Q13HW1"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW1"
FT                   /protein_id="ABE36328.1"
FT                   /translation="MYIATDHGHGQICIASTARYVPKARVHPEALPQKPVATAISMRDA
FT                   VMRSVHADTLRWRQQATPSVAANHPSRSVHPAMPAHVASEPHLSLSEMASAVAGEAIRR
FT                   YPSKEDHAPDQIIVCGTSLEHDLALSCAGRLHSELGSTGVPFAIGQIQGVSFFLALQVA
FT                   ADMMASDERMHTTLIVAAERWLPPFSRQTGSLTVLADGAAAILVSRGSCPGWHVRSLTV
FT                   CTPCTSVSIPPQDIRIDEAAVVEVIGQTCAQAGVKPTTFDWIVPPRINTTLACNVSAEA
FT                   RLPVWRMWYPEPGDIGYLCAADAPAQLHVLLQTVVPANGQRILLWSAGFQGQAACAVLE
FT                   YHGR"
     atgtacatcg caactgatca cggccacggg caaatctgca ttgcgtcgac agcgcggtat        60
     gtgccgaagg cacgtgtgca ccccgaagcg ctgccacaga agccagtggc aacggccatc       120
     tccatgcgcg acgccgtgat gcgatcggtc catgccgata cgctgcgctg gcgccaacag       180
     gcgacaccgt ctgtcgccgc aaatcatccg tcccggtccg tccacccggc gatgccggct       240
     catgtcgcca gcgagccaca cctcagcctc tcggaaatgg cctccgccgt agccggcgaa       300
     gctatccggc ggtatccctc aaaagaagac catgcgccgg accagatcat cgtatgtgga       360
     accagtcttg aacatgatct cgcgctgtcg tgcgcgggtc gcctgcacag cgaactcggg       420
     tcgacgggcg tgccgttcgc gattggacag atccagggcg tgtccttctt tcttgcgctg       480
     caggtggcgg ccgacatgat ggccagtgac gagcgcatgc acacgacact gatcgtcgcg       540
     gccgaacgct ggctcccgcc gttttcccgt cagaccggtt cgctgaccgt attggctgat       600
     ggcgcggcgg cgatcctggt cagccgtggg tcgtgtcccg gatggcacgt acgcagtctc       660
     acggtatgca cgccttgcac ctctgtgtcc atcccgccgc aggatatccg tatcgacgaa       720
     gcggccgtag tcgaagtcat tgggcagacg tgcgcacagg caggggttaa gcccactaca       780
     tttgactgga tcgtgccgcc gcgcatcaac accaccctgg catgcaacgt cagcgcagag       840
     gcccgactgc cagtctggcg aatgtggtat ccggagccag gcgatatcgg gtatctgtgc       900
     gccgcggacg cgccggcgca gctccacgtg ttgctgcaaa cggttgttcc ggctaacggg       960
     caacgcatcc tgctgtggtc ggccggcttc caggggcagg cggcatgcgc cgttctcgaa      1020
     taccacggga gatag                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page