(data stored in ACNUC7421 zone)

EMBL: CP000272.PE417

CP000272.PE417       Location/Qualifiers
FT   CDS_pept        463390..463647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36345"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU4"
FT                   /protein_id="ABE36345.1"
FT                   /translation="MIPETLIRKHRTVTRRHHSMPDPGFERRRRAVHYPAAAIINVPAA
FT                   PNVALSQRLQTWQSLEVVPSSKADATASAVPVRTSISLRS"
     ttgattccgg agacgttgat acgaaagcac agaacggtca cgaggcgtca ccattcgatg        60
     cctgacccgg gcttcgaacg gcgacgacgg gcagtgcatt atccggccgc agccatcatc       120
     aacgtaccgg cggctccaaa tgtagctctc tcgcagcggt tgcaaacctg gcaatcgcta       180
     gaagtcgttc ccagttcgaa agcggacgcc acggccagcg cagtgccggt cagaacatcg       240
     atctcgttgc gaagttga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page