(data stored in SCRATCH zone)

EMBL: CP000272.PE419

CP000272.PE419       Location/Qualifiers
FT   CDS_pept        complement(464113..464391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0443"
FT                   /product="Putative nitrogen regulatory protein NtrP"
FT                   /function="involved in nitrogen regulation"
FT                   /note="Citation: Mol. Plant Microbe Interact. 14 (7),887-
FT                   894 (2001)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36347"
FT                   /db_xref="GOA:Q13HU2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU2"
FT                   /protein_id="ABE36347.1"
FT                   /translation="MIVPIPTPSARPREARLFRNNRSQAVRIPVEFELPGDRVLIHREG
FT                   DKLIIEPVRTPANIIELLAAWRQELPPGPDDQFPDIEDPPVRPEDVL"
     gtgatcgtgc caatcccaac gccatccgcc cggcccaggg aggccaggct gttccgcaac        60
     aaccgcagcc aggcggtacg catccctgtc gagttcgagc tgccgggcga tcgcgttctg       120
     atccaccggg agggcgacaa gctcatcatc gaaccggtga ggacgcccgc gaacatcatc       180
     gaactgctcg ccgcgtggag acaggagctg ccgcccggac ctgatgacca gtttccggat       240
     atcgaagatc cgccagttcg accggaggac gtactttga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page