(data stored in ACNUC7421 zone)

EMBL: CP000272.PE42

CP000272.PE42        Location/Qualifiers
FT   CDS_pept        complement(50251..51843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0043"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35970"
FT                   /db_xref="GOA:Q13IW9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IW9"
FT                   /protein_id="ABE35970.1"
FT                   /translation="MTQTTPDSREDAWLERSRATLAKAQPGARAEAVGRVEHVADGIAL
FT                   VSGLPDVRLNELLRFEGDRFGFALTLDADTIGAVLLDDADAITAGSIVTGTGQVVQVPV
FT                   GPGLTGRVVDPLGRPLDGRGAVHADARMPIERPAPSIIERDLVAEPLATGILLIDALFA
FT                   IGRGQRELIIGDRATGKTAIAIDAIVNQKNSDVICVYVAIGQRASAVERVIAAVREHGA
FT                   PERCVFVFASSAASAGLQWIAPFSAMTIAEYFRDRGQHALVVIDDLTRHAATHRELALL
FT                   TREPPGREAYPGDIFYLHARLLERAAKLSPERGGGSLTALPIAETDAGNLSAYIPTNLI
FT                   SITDGQIVLDTGLFAANQRPAIDVGLSVSRVGGKAQMPALRNVSGRLRLDYSQFLELEM
FT                   FSRFGGLTEARVKAQVVRGERIRALITQPRFTPLRPVDEVALLGALAEGVFDALPVDLL
FT                   PAIRTRVAAHLDAHGGNAGAVLEDTGTLDATAQALLVAAVRTLAQDCATASATAPPDPP
FT                   AASAAELPQPDSP"
     atgacacaga ccacgcctga ttcccgcgag gatgcctggc tcgaacgcag ccgcgcaacg        60
     cttgcaaaag cacagccggg cgcgcgcgcc gaagccgtcg gccgggtcga gcacgtcgcc       120
     gacggcatcg cactcgtttc cggcctcccc gacgtgcgcc tgaacgagtt gctgcgcttc       180
     gagggcgacc ggttcggctt cgcgctgacg ctcgacgccg acaccatcgg cgcggtattg       240
     ctggacgacg ccgacgcgat taccgccggt tcgatcgtca ccggcaccgg gcaggtcgtc       300
     caggtgcccg tcgggccggg cctgaccggc cgcgtcgtcg atccgctcgg ccgcccgctc       360
     gacggtcgcg gcgctgtgca tgcggacgcg cggatgccga tcgaaaggcc cgctccgagc       420
     atcatcgagc gcgatctggt ggccgagccg ctcgccaccg ggatcctgtt gatcgatgcg       480
     ttgttcgcaa tcgggcgcgg gcagcgcgag ctgattatcg gcgaccgggc gaccggcaag       540
     accgcgatcg cgatcgatgc gatcgtcaat cagaagaaca gcgacgtgat ctgcgtctac       600
     gtggcgatcg gccagcgcgc atcggcggtc gaacgcgtga tcgcagcggt gcgcgagcac       660
     ggcgcgcccg aacgctgcgt cttcgtgttc gcttcgtcgg ccgcctccgc ggggctccag       720
     tggatcgccc ccttcagcgc gatgacgatt gccgagtact tccgcgaccg tggccagcac       780
     gcgctcgtcg tgatcgacga tctgacgagg catgcggcca ctcatcgcga actggcgttg       840
     ctcacccgcg agccgccggg acgcgaggct tatcccggcg atatcttcta tctgcatgcg       900
     cgccttcttg aacgcgcggc gaagctctcg ccggagcgcg gcggcggttc gttgacggcg       960
     ttgccgatcg cggaaaccga tgcgggcaac ctgtccgcgt atatcccgac caacctgatt      1020
     tcgattaccg atgggcagat cgtgctggat accggcctgt tcgccgccaa ccagcggccc      1080
     gcaatcgatg ttggcttgag cgtgagccgc gtcggcggca aggcgcagat gccggcgttg      1140
     cgaaacgtgt cggggcgctt gcgtctggac tattctcagt ttctggaact ggagatgttc      1200
     tcgcgcttcg gtggcctgac cgaggcccgt gtgaaggcgc aggtcgtgcg cggcgaacgt      1260
     atccgcgcgc tgattaccca accgcgcttc acgccgctgc gtcccgtcga cgaggtcgcg      1320
     cttcttggcg cgctggccga aggcgtattc gacgcgctcc cggtcgacct cctcccggcg      1380
     atacgaacgc gcgttgcagc gcatctcgat gcgcatggtg gaaatgccgg cgccgtgctc      1440
     gaagacaccg gcaccctcga cgctacggcg caagcactgc tcgtggcggc cgtccggacc      1500
     ctcgcccagg attgcgcgac ggccagcgca acggctccgc cggacccacc ggcggcatcg      1560
     gcagccgagt tgccccagcc ggactcgcca tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page