(data stored in ACNUC7421 zone)

EMBL: CP000272.PE421

CP000272.PE421       Location/Qualifiers
FT   CDS_pept        466115..466975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU0"
FT                   /protein_id="ABE36349.1"
FT                   /translation="MKSLLIISAEGNSGRTMLTCLFARHLHRINHWRVLVLDLAEPPCC
FT                   AQMLAGCGLDTTGSGNRAPDLHECASPLTGGCLRVLSADAIDALRARDDPACTRYYANL
FT                   RHLLSVVAPWFDVCLIDAPILPDLRAVCAEALADAVLSPLAMSPDCIGCASEVINGTYG
FT                   IRNVRARLNPALRFAGLLPVVDVPSSMEEAWVKVMETTLREWLIVDRAFPHGYAWLPRM
FT                   WSVMRSVGRVEKRPAPHGYVAAQDVGVAEASRTVTACLNVLTRRLAAIGKDAVHGFRDA
FT                   EVCDA"
     atgaaatcgc ttctgatcat ttcggcagag ggtaattcgg gcagaacgat gctgacctgc        60
     ctgtttgccc gtcacctgca tcgcatcaac cattggcgcg tgctcgtgct ggacctggct       120
     gagccgccgt gctgcgcaca gatgctcgcc ggctgcggac ttgacacgac aggctccggc       180
     aaccgtgcgc cggatctgca cgagtgcgcc agcccgctaa cgggtgggtg ccttcgcgtc       240
     ctcagcgccg acgccatcga cgctctgcgc gcgcgcgatg atcccgcatg cacccgctat       300
     tacgcgaacc ttcgtcacct gctgtctgtc gtggcgccgt ggttcgacgt gtgcctgatc       360
     gatgcgccta tcctgccgga cttgcgcgct gtctgtgcgg aggcgctggc ggatgcggtg       420
     ctgagcccac tcgcgatgtc gccggactgt atcggatgcg cttccgaggt catcaacggc       480
     acatacggaa tccgcaatgt ccgcgcgcga ctgaatccgg cattgcgctt tgccgggctt       540
     ctgccggttg tcgacgtccc ttcgtcgatg gaagaggcgt gggtgaaggt gatggaaacg       600
     acgctgcgtg agtggctgat cgtggaccgg gcctttcccc acggatacgc gtggctgcct       660
     cgtatgtggt ccgttatgag gtccgtcggg cgcgttgaaa aacgcccggc gccgcacggt       720
     tacgttgccg cgcaggacgt cggagtagcc gaagcgtcgc ggacggtgac ggcctgtctg       780
     aatgtgctca cacggcggct tgctgcaatc gggaaggatg cggtgcacgg cttccgcgat       840
     gcggaggtgt gtgatgcatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page