(data stored in SCRATCH zone)

EMBL: CP000272.PE422

CP000272.PE422       Location/Qualifiers
FT   CDS_pept        466968..467546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36350"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT9"
FT                   /protein_id="ABE36350.1"
FT                   /translation="MHDAAISFDIAVTGRALLRALRRWSTAIAAFVGISILAPGTARAD
FT                   DWGCQVVLCLSNPGGPEQYGECVPPIEKLWAALRHGDPFPTCDFGAGGAQGTSAVNIFA
FT                   SAGYCREDLLYWGGPEQSELLCNARGAINVEIDGALYTRVWWDARGADRTITEFYGAGS
FT                   TAVPYEPTRSARLFLEREYGGSGGQGGGE"
     atgcatgacg ctgccatctc attcgatatt gcggtcaccg gtcgagcgtt gctgcgggcg        60
     ttgcgccgct ggtcaaccgc catcgcagca ttcgtcggta tatcaatcct ggcgccgggc       120
     actgcccgtg ccgacgactg gggctgccag gtggtcctgt gcctgtccaa tcccggtggt       180
     cctgaacagt acggtgagtg cgtcccgcca atcgagaaac tgtgggcggc cttgcgccac       240
     ggcgaccctt ttccgacctg cgacttcggc gcaggcggcg cacagggaac gtcggccgtg       300
     aacatttttg cgagtgccgg ttactgccgc gaggatctgc tgtactgggg gggccccgag       360
     cagagcgagc tgctgtgcaa tgcgcgtggc gcgattaacg tcgagatcga cggcgcactg       420
     tacacgcggg tctggtggga tgcgagaggc gcggaccgca cgatcacgga gttctacggg       480
     gctggcagta cggcggttcc gtatgagccg acccggtcgg cgcgcctctt tctcgagcgg       540
     gagtacgggg gctcgggcgg acagggaggt ggcgaatga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page