(data stored in ACNUC7421 zone)

EMBL: CP000272.PE423

CP000272.PE423       Location/Qualifiers
FT   CDS_pept        467543..468190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0447"
FT                   /product="Putative type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36351"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT8"
FT                   /protein_id="ABE36351.1"
FT                   /translation="MIPLAAFLALTQQCAPAVAPATMAAIVRVESGFDPYAIGVVRGRL
FT                   ERQPANLDEAIATTRALEAGGWNYSAGLAQVNRANWVRLGLTPQAVFDPCRNLAAGAAI
FT                   LQGCFERARLRHPEAQNALRAGLSCYASGDFSSGFRTGYVQRVVAQAARPDPVVPAITT
FT                   DVPPIRVIPSSPQDARSGALRIPDGTPSTTDGRRNRPIGEPGDVTQESAVVF"
     atgattccgc tcgccgcatt tcttgccctg acacagcagt gcgcgccggc cgtggcgccc        60
     gccacgatgg cagccatcgt gcgggtcgag tcaggcttcg acccgtacgc gatcggggtg       120
     gtacgcggcc gcctcgagcg gcagcccgcg aacctcgatg aggccatagc gacaacacgt       180
     gcgctggagg ccggcggatg gaattacagc gcaggactcg cacaggtgaa ccgcgcgaac       240
     tgggtccggc tcgggctgac gccgcaggcc gttttcgatc cttgccgcaa tctcgctgcc       300
     ggggcggcca ttctccaggg ctgcttcgag cgcgcgcggc tcaggcaccc ggaagcgcag       360
     aacgcattgc gcgcggggct ctcgtgctac gcgagcggag acttttccag cggattccgg       420
     acgggctatg tgcagcgggt cgtcgcccag gctgcgcggc cggatccggt ggttccggcc       480
     attaccaccg atgttccgcc cattcgcgtc attccgtcca gtccgcagga cgcacgttct       540
     ggcgccttgc gaattccgga tggaacgcct tcgaccacag acggcaggcg aaatcgcccg       600
     atcggtgaac ccggtgacgt gactcaggaa agtgctgtcg tcttctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page