(data stored in ACNUC7421 zone)

EMBL: CP000272.PE424

CP000272.PE424       Location/Qualifiers
FT   CDS_pept        468226..468561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0448"
FT                   /product="Putative type IV secretion system protein
FT                   VirB2/TraC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36352"
FT                   /db_xref="GOA:Q13HT7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT7"
FT                   /protein_id="ABE36352.1"
FT                   /translation="MKSGLQMKWKTIRLATRVLASVRAGRNGLAVAALLTVTPAYAQLS
FT                   QVNTLLTTIQTTLLSVGAVVCSISIIWAGFKMMFQHARFGDIANVFIGGLFVGCATVIA
FT                   AMLIPTS"
     atgaaatcag gactacagat gaaatggaaa actatccggt tggcgacgcg ggttctcgcg        60
     tcggtgcgag ccggtcgcaa cgggctcgcg gtcgctgctc tgctgacggt gacgccggca       120
     tacgcgcagc tctcgcaggt caacacgctg ctcacgacga tccagaccac gctgcttagc       180
     gtgggcgcgg tggtgtgctc gatctcgatc atctgggcgg gcttcaagat gatgttccag       240
     cacgcgcgct ttggcgacat tgccaacgtg ttcatcggcg gcctgttcgt gggctgcgcc       300
     acggtgatcg cggcgatgct gatcccgacg agctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page