(data stored in ACNUC7421 zone)

EMBL: CP000272.PE426

CP000272.PE426       Location/Qualifiers
FT   CDS_pept        468909..471380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0450"
FT                   /product="Putative Type IV secretion system protein
FT                   VirB4/TraE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36354"
FT                   /db_xref="GOA:Q13HT5"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT5"
FT                   /protein_id="ABE36354.1"
FT                   /translation="MSAQPQLIEVAEREVVLADFVPFSSHVTDHVIRTREGDYLSVWKI
FT                   AGIAFEAADPGDILVRHEGFNQLVRSLPGGHVGLWSHRIRRRVTDHFATPYGHPFCQEL
FT                   ATRYYASFAGYRMMANELYLTLVYRPRRTRLGRLFSQAARRTLDDIRRDQHEALKVMAE
FT                   LAAQVESGLKPWDPVALGVYRKQIRYTQRPVRFSAALEFLGYLVNAAWEPVPVPSGRIA
FT                   EALPTSRLFFRTEKVEIRMADATRYAALLDLKDYPEETEPGMLDGLLYGDFEYIETQSF
FT                   TILDRPTAKEALERQRNQMIAGEDVAVSQVQAMDQALDDLINGDFVLGEYHYSLAVLGD
FT                   RPDEVARHVAKARTQLADVGFQTALVDLVADAAWFAQLPGNWRYRPREAKLTSRNFCGL
FT                   ASLHNFATGKREGNPWGEAITIVKTPSGQPLYLNFHATPEKKESADEKALANTQIIGQA
FT                   GAGKTVLELFLLAMAMKYGLTGVVYDKDRGTEIAIRAMGGRYTVFRRGVPTGLNPFQLD
FT                   PDETVLDFWERLVRRLVDTGTLLSAKDELDISRAVREVARMERPLRRLSMVRQLLPAVG
FT                   ENSLHARLTKWCAGGRLGWVLDNPSDLLDFSQNRLFGFDDTELLDDPEVSTPVTMYLLQ
FT                   LTESLIDGRRFVYVMTEFWKRLGDPVFTDFAKDKQKTIRKQNGLGIFDTQSPADVLRSD
FT                   IARALVEQTATFFFLPNPRADYDDYVHGFKLTEAEFNIVRSLGENSRLFLVKQGHRSAI
FT                   GRLDLAGLGDVLDVLSGTTDNVELLDGIRAEVGDDPGVWLPVFHERLAKRRATGGALNA
FT                   LTPRLSGRGAR"
     atgagtgcac agccgcaact catcgaggtg gccgaacgtg aggtggtgct cgcggacttt        60
     gtcccgtttt cgtcgcacgt gaccgatcac gtgatccgca cgcgggaagg ggattacctg       120
     agtgtctgga agatcgcggg cattgccttc gaggcggccg atccaggcga catcctcgtg       180
     cgtcacgaag gattcaacca gctcgtgcgc agcctgccgg gaggtcacgt cggcctgtgg       240
     tcgcaccgga tccgccggcg cgtgacggac cactttgcga cgccgtacgg ccacccgttc       300
     tgccaggagc tcgccacgcg ctactacgcg agctttgcgg gctaccggat gatggccaac       360
     gaactgtacc tgacgctcgt gtaccggccg cgccgcacgc gcctggggcg tcttttcagc       420
     caggcggcgc ggcggaccct cgatgatatt cggcgggacc agcacgaggc cctgaaggtg       480
     atggcggagc ttgccgcgca ggtcgaatcg ggccttaagc cctgggaccc ggtggcgctt       540
     ggtgtctaca ggaagcagat ccgctacacg cagcgccccg tgcgtttctc cgcggcgctg       600
     gagttcctgg gctatctcgt caacgccgca tgggagcccg tgccggtgcc gtctggccgc       660
     attgccgagg cactgccgac gtcgcggctt ttcttccgca ccgagaaggt cgagatccgc       720
     atggccgatg cgacgcgcta cgccgcgttg ctcgacctga aggactaccc cgaggaaacc       780
     gagccgggga tgctcgacgg tctgctctat ggcgacttcg aatacatcga gacccagagt       840
     ttcacgatcc ttgaccgtcc cacggcaaaa gaggcactcg agcgtcagcg caaccagatg       900
     attgctggcg aggacgtggc ggtctcgcag gtccaggcta tggaccaggc gctggacgat       960
     ctgatcaatg gtgatttcgt cctcggtgaa tatcactatt cgctcgcggt gctcggtgac      1020
     aggcccgacg aggtcgcgcg gcatgtggcg aaggcgcgca cacaactcgc ggacgtgggc      1080
     ttccagacgg cgctggtcga tctggtagcg gatgcggcct ggttcgcgca gctgcctggt      1140
     aactggcgct accggccacg ggaggcgaag ctcacctcgc gcaacttctg cggactcgcg      1200
     agcctgcaca actttgcgac cggcaagcgc gaaggcaatc cgtggggcga ggcgatcacg      1260
     atcgtgaaga cgccgagtgg gcaaccgctg tacctgaact tccacgccac gccggagaag      1320
     aaggagtccg ctgacgagaa ggcgctcgcc aacacgcaga tcatcggaca ggcgggtgcc      1380
     ggcaagacgg tgttggagct gttcctgctg gcaatggcga tgaagtatgg cctcaccggc      1440
     gtcgtctacg acaaggaccg gggcactgag atcgcgatcc gggcgatggg aggccgctac      1500
     acggtgtttc gacggggtgt cccgacggga ttgaatccgt tccagctcga cccggacgag      1560
     acggtactgg acttctggga gcggctcgtg cgccgtctgg tcgacaccgg cacgctgttg      1620
     tcggcgaagg acgaactcga catttcgcgt gcagtgcggg aagtcgcccg catggagcgc      1680
     ccgttgcgcc gcctgtcgat ggtccggcaa ttgctgcccg ccgtgggcga aaacagcctg      1740
     catgcacgcc tcacgaagtg gtgcgcaggc ggacgactcg gctgggtgct ggacaacccg      1800
     tcggacctgc tggatttcag ccagaaccgt ctcttcggct tcgacgatac ggagctgctc      1860
     gacgatccgg aggtgtcgac gccggtcacg atgtacctgt tgcagctgac cgaaagcctg      1920
     atcgacgggc ggcgctttgt gtatgtgatg accgaattct ggaagcgcct gggcgatccg      1980
     gtcttcacgg atttcgcaaa ggacaagcag aagacgatcc gcaagcagaa cggtctgggg      2040
     atcttcgaca cgcaatcccc agccgatgta ctgcgtagcg acatcgcgcg ggcgctggtc      2100
     gagcagaccg ccacgttctt ctttctgccg aatccgcgtg ccgactacga cgactacgtg      2160
     catggcttca agctgaccga ggccgaattc aacatcgtcc gctcactcgg cgagaacagt      2220
     cgcctgttcc ttgtgaagca gggccaccgt tcggccatcg gcaggctgga tctggccggc      2280
     ctcggtgacg tgctcgacgt gctgtcgggg acgacggaca acgttgagct gctcgacggg      2340
     atccgtgccg aagtgggcga cgatcccggc gtgtggctcc ccgtgtttca tgagcggctg      2400
     gcgaagcgtc gtgcgaccgg gggcgccctg aatgcactga cgccgcgtct gtcgggaaga      2460
     ggtgcacgat ga                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page