(data stored in ACNUC7421 zone)

EMBL: CP000272.PE427

CP000272.PE427       Location/Qualifiers
FT   CDS_pept        471377..472534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0451"
FT                   /product="Putative type IV secretion system protein
FT                   VirB6/TraH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36355"
FT                   /db_xref="GOA:Q13HT4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT4"
FT                   /protein_id="ABE36355.1"
FT                   /translation="MSGLFTAVGGTLENGMSTYVTSVSSALSSALVPVVTTALSIWIIT
FT                   YGFAVVRGEAHESVPAFAWRGLKVAVMLAFALGAGIYQSQVVTAVEGATTGLAQTIQTA
FT                   AANAGAGNPGCGTASGSSVTGTSASAIYQTLDCYDRQIDLVMDAYFNKATHEGFSVAGI
FT                   VAGIGDFACGLVAALGASVFLIVLAFEVVMARLLLDLVLGLGPLFIACGAFSPTARFFE
FT                   AWTAKIANYALLQVLIAAFLGMALTAFSADLAPFQVTSASPDANASTLTAAVQGALDNA
FT                   ASWGAGLGMCAAGVLLATVGWQLPAVASGLAGGATMSGFGAFVAGYAARQALRGVGAAM
FT                   RFGHGPRGPGGKISDGGAGSGSIPLYQRAAREHMGDQGNDGGSTS"
     atgagcggcc ttttcactgc agtcggcggc acgctcgaga acggcatgtc gacgtatgtc        60
     acgagcgtgt cctcagccct gtccagcgcg ctggtacccg ttgtcacgac ggccctgtcg       120
     atctggatca tcacgtacgg gttcgccgta gtacgcggcg aggcccatga gtcggtacct       180
     gcattcgcgt ggcgtggcct gaaggtggcc gtcatgctcg ccttcgcgct cggcgcgggc       240
     atctatcagt cccaggttgt cacggcagtc gaaggggcga cgacgggcct tgcccagacg       300
     atccagaccg cggcggccaa tgccggtgct ggcaaccccg gttgcggaac ggcgagtggc       360
     agcagcgtga caggcacgag cgcgtcggcc atttaccaga cgctcgattg ctatgaccgt       420
     cagatcgatc tggtgatgga tgcgtacttc aacaaggcga cgcacgaagg tttcagcgtc       480
     gccggaatcg tcgcgggcat cggcgatttt gcctgtgggc tggtggcggc actcggcgcg       540
     tcggtcttcc tcattgtcct cgcattcgaa gtggtgatgg cgaggctcct gctggatctg       600
     gtgctcggcc ttggtcccct gttcatcgcc tgcggggcat tcagccccac cgcccggttc       660
     ttcgaggcgt ggaccgcaaa gattgccaat tacgcgctgc tgcaggtgct catcgcagcg       720
     tttctgggca tggccttgac ggcgttttca gcggatcttg cgccgttcca ggtgacgagc       780
     gcgtcgcccg atgccaacgc ctccacgctg acggcggctg tccagggcgc gctcgataac       840
     gccgcatcct ggggggcagg acttgggatg tgcgcagctg gggtgttgct ggccaccgtc       900
     ggttggcaac tgccagcggt cgcctcagga cttgccggag gcgccacgat gtccgggttc       960
     ggtgccttcg ttgcaggata cgcagcgcgg caggcacttc gcggcgtcgg cgccgccatg      1020
     cgcttcggac acggtccgcg ggggccaggc ggaaaaattt cggatggcgg agcgggaagc      1080
     ggttcgatac cactctacca gcgtgctgcc cgcgagcata tgggcgatca gggaaacgat      1140
     ggaggatcaa catcatga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page