(data stored in ACNUC7421 zone)

EMBL: CP000272.PE43

CP000272.PE43        Location/Qualifiers
FT   CDS_pept        complement(51824..52570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0044"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35971"
FT                   /db_xref="GOA:Q13IW8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW8"
FT                   /protein_id="ABE35971.1"
FT                   /translation="MHIDGWTLGLQTVNVLVLVWLLARYLFRPVAKIIAARQQAATALM
FT                   ADAANARAAALAERSQAADQAAQIAQQRGDLLAAASAEAAALKTSLESAARADADRLRL
FT                   AAQADLATARQAAAAADANRASRLAIGIAAKLIDRLPQETRIAGFIEGLAAELAKLPAA
FT                   TRAELSPDAPVHLLAPRALKDDELAACHAALARVLGRDLPLPVTVEPALLVGLELEAPH
FT                   AIVRNSFRADLAYLQSELLAHDTDHA"
     atgcatatcg acggctggac gctcggactg caaacggtca acgtgctcgt gctcgtctgg        60
     ctgctggcgc gttatctgtt ccggccggtc gcaaagataa tcgccgcgcg ccagcaggcc       120
     gccaccgcgc tcatggccga tgccgcgaac gccagggcgg cggcgctcgc cgaacgaagc       180
     caggcggcgg accaggcagc gcagatcgcg cagcaacgtg gcgatctgct cgcagcggca       240
     tcggcggaag ccgccgcgtt gaaaacgtcg cttgaaagcg ccgctcgcgc ggacgcggac       300
     cgcctgcgcc tcgcggccca ggccgacctc gcaaccgcgc ggcaagcggc tgccgcggcc       360
     gacgccaacc gggcttcgcg gctcgccatt ggcatcgcgg caaagctgat cgaccggctg       420
     ccgcaggaaa cgcgtatcgc gggcttcatc gagggtcttg ctgccgagct cgcgaagctg       480
     cccgcggcga cgcgcgcgga gttgagtcct gacgcaccgg tccatctgct cgcaccgcgc       540
     gcgctgaagg acgatgagct ggccgcatgc cacgcagcgc tggcgcgcgt gctgggccgc       600
     gacctgccgc ttcccgtcac cgtcgagccc gccctgctgg tggggctcga actcgaagca       660
     ccgcatgcga tcgtgcgcaa cagcttccgc gccgacctcg cctatctcca gtccgaactg       720
     ctcgcccatg acacagacca cgcctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page