(data stored in ACNUC7421 zone)

EMBL: CP000272.PE431

CP000272.PE431       Location/Qualifiers
FT   CDS_pept        475014..476222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0455"
FT                   /product="Putative type IV secretion system protein VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36359"
FT                   /db_xref="GOA:Q13HT0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT0"
FT                   /protein_id="ABE36359.1"
FT                   /translation="MNEETSRNVIAPDTDPAKVTDTINGDLPNQPIDRGMPELGQQGGR
FT                   ARAWWLAPLVIVALVIGGAAWTIHGFLVRHDAAEKARRDAVQDQPSQGRVFGDGNPPAS
FT                   AAAAAAASSPAGAATVASAPAAVSTRQVPVHTAPARSYYDAPLLATGGAGAGNGPADER
FT                   ADPAVSAAGVSPGATVVSGSQSQGSGPLARALTPTVTPKVRAGFLGNRSMILAEGAKID
FT                   CAGDTAFDSTQAGISTCTVTKNVYSDDGRVVLIERGSQINSEYRSNLAPGQKRVFILSA
FT                   RIRTPEGVTVEIDSPAADALGRIGVSGYVNNHWGERIGAAMLLGMTQDAIGYLATRGGN
FT                   SNGSVVFENTQQQGNDMASRVLDSTINIPPTLTQNQGAEFTIIVARDLDFSPVYALEPG
FT                   GTR"
     atgaatgaag aaacgtcgcg caatgttatt gcgcctgaca ctgacccggc gaaggtcacc        60
     gataccataa acggtgacct cccgaaccag ccgatcgatc gcggcatgcc ggaactgggg       120
     cagcagggtg gccgagcccg tgcctggtgg cttgcgccgc tggtcatcgt ggctctcgtg       180
     atcggtggag cggcctggac gatccacggg tttctcgtgc ggcacgatgc ggcggagaag       240
     gccaggcgcg atgcggtgca ggatcagccg tcccagggac gggtgttcgg cgacgggaac       300
     ccaccggcat cggctgctgc tgccgctgcc gcaagcagcc cggcgggagc agccaccgtt       360
     gcgtcggctc ccgctgcggt gtcgacgcgg caggtacctg tgcacactgc accagctcgc       420
     agctactacg acgcaccgct actcgccacc ggaggtgcgg gcgctggcaa tggccccgcc       480
     gacgaacggg cagacccggc ggtatcagcg gcaggcgttt cgccaggagc gactgtcgta       540
     tccggcagcc agtctcaggg aagcggtcct ttggcccggg cattgacgcc gacggtgacg       600
     cccaaagtgc gcgcggggtt tctcggcaat cgcagcatga tcctcgcgga aggcgccaag       660
     atcgactgcg ccggcgatac ggcatttgat tcgacccagg cgggtatctc gacctgcacg       720
     gtgacgaaga acgtctattc ggatgacggc cgtgtcgtgc tgatcgagcg cggctcgcag       780
     atcaacagcg agtaccgctc gaacctggcg cccggacaga agcgggtgtt catcctgtcg       840
     gcacgcatca ggacccccga gggtgtgacg gtcgagatcg attctcccgc ggcggatgcg       900
     ctggggcgca tcggggtgag cggatacgtg aacaaccatt ggggcgagcg tatcggcgcg       960
     gccatgctgc ttggcatgac gcaggacgcg atcgggtatc tcgcgacgcg tggcggcaac      1020
     agcaacggct cggtcgtatt cgagaacacg cagcagcagg gcaacgacat ggcctcgcgc      1080
     gtgctcgaca gcacgatcaa cattccgccc accctgacac agaaccaggg ggccgagttc      1140
     acgattatcg ttgcccggga tctggacttc agtccggtct acgcgctgga gccggggggt      1200
     acgcgatga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page