(data stored in ACNUC7421 zone)

EMBL: CP000272.PE432

CP000272.PE432       Location/Qualifiers
FT   CDS_pept        476219..477358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0456"
FT                   /product="Putative type IV secretion system protein VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36360"
FT                   /db_xref="GOA:Q13HS9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS9"
FT                   /protein_id="ABE36360.1"
FT                   /translation="MKASAHILSEAPVPADGLLPRLAEDASVRELMRPLAGLLADPALT
FT                   ELVINRPQRVLTETHLGWQAHDCADLDFERLMSFAVAIATLTNQEVSALHPVLSALLPG
FT                   DARVQVVIPPVVPPRTVSVTIRRPSSREKTLDAYGNEGLFSQTRWHRPAGLDEAMPALR
FT                   PLDRDLARCLEAREFPAFFERAVRGRLNLVIVGSTGSGKTSFMKTLCRSIPATERIVTI
FT                   EDVRELFIHHIENCVHLIYSKGGHGQARVTPADLIASSMRMRPDRVLLAELRGSEAYDF
FT                   LKLLTTGHSGSITSYHASSAAVAIERFALMAKEHPEAATWDDVALRRLLFMTIDVVAHM
FT                   ESTALFDETGVQTGRRWSMTEVWFDPLRRHQTDYHADFR"
     atgaaagcat cggcccatat cctgagtgaa gcgccggtac cggctgacgg cctgctgccc        60
     aggctggcag aggatgcttc ggtgcgcgag ctgatgcgcc cactcgcggg gctgctcgca       120
     gacccggcgc tcacggagct ggtgatcaac cggccgcagc gcgtgctgac cgaaacccat       180
     ctcggatggc aggcacacga ctgtgcggac cttgacttcg agcgcctgat gtcattcgcg       240
     gtggcgatcg ccacgctcac aaaccaggag gtctcggcgc tgcatccggt gctctccgcg       300
     ctgctgcccg gtgatgcgcg cgtccaggtc gtgatcccgc cggtggtgcc cccgcgtacc       360
     gtgtcggtga cgatccgccg tccgtcgtcg cgcgagaaga cactcgacgc ctacggaaac       420
     gagggcctgt tctcgcagac tagatggcac cgcccggctg gacttgatga ggcgatgccg       480
     gcactgcgcc ccctggatcg ggatctcgcc agatgccttg aagcgcgcga gttcccggct       540
     ttcttcgagc gggcggtgcg cggccggctg aacctcgtga tcgtgggcag cacaggctcg       600
     ggcaagacga gcttcatgaa gacgctgtgc cggtccatcc cggctaccga acgcatcgtg       660
     acgattgagg atgtgcgcga gctcttcatc catcacatcg agaattgcgt ccacctgatt       720
     tacagcaagg gtggccacgg ccaggcgcgg gtgacgcctg ccgatctgat cgcaagctcg       780
     atgcgcatgc gccctgatcg agtgctgctc gccgaactgc ggggcagcga agcgtacgac       840
     ttcctgaagc tgctgacgac cgggcactcc ggttcgatca cgagctatca cgcgtcgagt       900
     gccgccgttg cgattgaacg ctttgcgttg atggcgaagg aacatcccga agccgccaca       960
     tgggacgacg tcgcactgcg ccggctgctc ttcatgacga tcgacgttgt ggcgcacatg      1020
     gagtccaccg cgctcttcga tgagacaggc gtgcagaccg gccggcgctg gtcgatgacg      1080
     gaggtctggt tcgatccgct gcgccgccat cagacggact atcacgcgga tttccggtga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page