(data stored in ACNUC7421 zone)

EMBL: CP000272.PE434

CP000272.PE434       Location/Qualifiers
FT   CDS_pept        477771..479552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0458"
FT                   /product="Putative type IV secretory pathway protein VirD4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36362"
FT                   /db_xref="GOA:Q13HS7"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS7"
FT                   /protein_id="ABE36362.1"
FT                   /translation="MSAATHSGGYGGPPLVVGVWRGRYLRFTGQQFVLLAAPARSGKGV
FT                   GIVVPNLLSYPDSVVVLDIKQENFNLTAGFRRAHGHDVYLFNPFAEDGRTHRYNPLSAI
FT                   SDGVFRVGDILAIGYALYPVGGHDDFWKDQARNLFLGIVLLLCEWRDACRTGNTDVPDY
FT                   PVTMGEVLRQSSGNGMPVKAYLQQALLQNRRLLSGACVDALNRFLANDDKVLASILATF
FT                   NAPLTIWANPIVDAATSANDFDLRDVRKRRMSVYVGITPDHLSEAALLVNLVFSQLVNL
FT                   NTRQLPQDSPELKVQCLLLMDEFTSVGKIHIIARAVAYMAGYNLRLLSIVQSVSQLESV
FT                   YGRADARTFVTNHAMQIIYAPREQKDANEYSEMLGTFTDRSRSVSRSNAVFGGRGGSSE
FT                   SFSEQRRPLLLPQELKELGREKEIILLENTKPILAERICYWRDPVFTSRLVAAPAIPAM
FT                   DLVRFIAQVERRVRDVQPDDVDEAGVMHIPPEYLEVLQAWDPRDLPRHLNDVTDEEAAA
FT                   YVERHFMLLGVPAARVAVAARRLSPSDLDVAELRPADRAPKRKSARSTGASRKQHGPAT
FT                   SRPTDGSNVVPLHGERR"
     atgagcgcgg cgacgcattc aggcggatac ggtggacctc ctctggtcgt gggcgtctgg        60
     cgtggccgct atctgcggtt caccggccag cagttcgtgc tgctcgcggc accggcgcgc       120
     tcgggcaagg gcgtgggcat cgtggtgccc aatctgctca gctacccgga ttcggtggtt       180
     gtgctcgaca tcaagcagga gaacttcaac ctgaccgcag gattccgtcg tgcgcacggg       240
     catgacgtgt acctgttcaa cccgtttgcc gaggacggcc gtacgcaccg gtataacccg       300
     ctgtcggcga tttcggatgg cgtattccgc gttggcgaca tcctggcgat cggctacgcg       360
     ctgtatccgg ttggcggtca cgacgacttc tggaaggacc aggcacgcaa tctctttctc       420
     gggatcgtgc tgctgctgtg cgagtggcgc gatgcgtgcc gcaccggcaa caccgatgtg       480
     cccgactacc cggtgacgat gggcgaggta ctgcggcagt catcgggcaa cggcatgccc       540
     gtcaaggcat acctgcagca ggcgctgctg cagaaccggc gactgctcag tggcgcgtgc       600
     gtcgatgcgc tcaaccgctt tctcgcgaac gacgacaagg tgctcgcgag cattctcgca       660
     accttcaatg cgccgctcac gatctgggcc aatccgattg tcgacgccgc gacgagtgcc       720
     aatgacttcg acctgcgcga tgtgcgcaaa cggcgcatgt cggtctatgt cgggatcacg       780
     ccggaccacc tgagcgaggc agcgctgctc gtcaaccttg tgttctcaca actcgtcaac       840
     cttaatacgc gacaactgcc ccaggacagt ccggagctga aggtccagtg tctgctgctg       900
     atggacgaat tcacgtcggt tggcaagatt cacatcattg cccgcgcagt cgcctatatg       960
     gcgggataca acctgcggct gctctcgatc gtgcagtcgg tgtcgcagct cgagtcggtc      1020
     tatggccggg cggacgccag gacgttcgtc accaatcacg cgatgcagat catctatgcg      1080
     ccgcgtgagc agaaggacgc gaacgaatac tcggagatgc tcggtacctt cacggaccgc      1140
     tcgcgcagcg tgagccggtc gaacgcggta tttggcgggc gcggcgggtc gagcgagagt      1200
     ttctctgagc agcgccgtcc gctgctgctg ccgcaggagc tgaaggaact cggacgtgag      1260
     aaggaaatta tcctgctcga aaatacgaag ccgatcctgg cggagcggat ctgctactgg      1320
     cgcgaccctg ttttcacgtc acgtctggtg gctgcgccag cgattccagc gatggatctc      1380
     gtgcgcttca tcgcccaggt tgagcggcgg gtgagggatg tgcaaccgga cgacgtggac      1440
     gaagccggcg tgatgcacat tcccccggag tatctggaag tgctgcaggc ctgggatcca      1500
     cgcgacctgc cacggcatct caacgacgtg accgacgaag aggcggccgc ctacgtcgag      1560
     cgacatttca tgctgctggg cgtgcccgct gcgcgcgtgg ccgtggcagc gcgccgcctg      1620
     tcgccgtccg atcttgatgt ggcggaactg cgccccgcgg atcgagcgcc gaaacgcaag      1680
     tccgcgcgca gcacaggtgc ctcgcggaaa caacacgggc ccgcgacatc gcgcccaact      1740
     gacggctcga acgtggtgcc gcttcacgga gaacgccgat ga                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page