(data stored in ACNUC7421 zone)

EMBL: CP000272.PE441

CP000272.PE441       Location/Qualifiers
FT   CDS_pept        complement(486290..486664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36369"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS0"
FT                   /protein_id="ABE36369.1"
FT                   /translation="MGLSVTEIGIAASVPVTRSMHMKEPPITNLHADTTALPEQLFAKT
FT                   LAEPLQQHVLHASLSRLASLGILAPKPAITAASGAVAIVDTATDQRCHILDLRTPGKIA
FT                   AAVALPQIVTRVDAFGWIKD"
     gtgggcctca gtgttaccga aatcggaatc gcggcttccg tgcccgtgac cagatcgatg        60
     cacatgaaag aaccgccaat caccaatctt catgccgaca cgactgcgct tccagaacaa       120
     ctcttcgcga aaacactggc cgaaccactg caacagcacg tccttcacgc aagcctttcg       180
     cgcctggcgt cgctgggaat cctggcgcca aaaccagcaa tcacagctgc atccggagca       240
     gttgccatcg tcgatacggc aaccgatcaa cggtgccata tcctggatct gcggacgccg       300
     ggcaagatcg cggccgcagt ggctcttccg caaatcgtta cgcgggtaga cgcgtttggc       360
     tggatcaagg actga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page