(data stored in ACNUC7421 zone)

EMBL: CP000272.PE442

CP000272.PE442       Location/Qualifiers
FT   CDS_pept        complement(486737..487108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36370"
FT                   /db_xref="GOA:Q13HR9"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR9"
FT                   /protein_id="ABE36370.1"
FT                   /translation="MNSASRERNPPFTNATGTPNSSDLRAVRHFRTDGIFACVTPESTN
FT                   LPSSGHLILWRFRADWRSASRDEAYSWLSVAKRERAKRYPNRAAAKRYLVGRATLRQIL
FT                   SRMLDCGPGTVVLGDGADG"
     ttgaactccg cttcgagaga aaggaacccg ccattcacaa atgcgacggg gacaccgaat        60
     tcatcggacc ttcgtgcagt gcgtcacttc aggaccgacg gaatcttcgc ctgcgtgacc       120
     cccgagtcca caaaccttcc ttcctcgggg cacctaatcc tgtggcgttt tcgggccgac       180
     tggcgctcgg cgtcacgcga tgaggcatat tcctggctct ccgttgccaa gcgtgaacga       240
     gcgaagcgtt atcctaatcg tgcggccgcg aaacgctatc tggtgggacg cgcaacgcta       300
     cgacagattc tgtctcgcat gcttgactgt gggccaggta ccgtcgtgct tggcgacgga       360
     gcggacggat aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page