(data stored in ACNUC7421 zone)

EMBL: CP000272.PE450

CP000272.PE450       Location/Qualifiers
FT   CDS_pept        492246..492950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36378"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR1"
FT                   /protein_id="ABE36378.1"
FT                   /translation="MNKTVDMTVNTIYLVGGGKGGVGKSVVALALVDHLQRRGVNTVLV
FT                   ENDTSNPDVMRAVHEEIACASFDLDTAGGWIDMVNYCDGHRDAVVVVSTAARNQDGVTR
FT                   YGATLGSTLDELGRRLVVFWVINRQRDSLELLRQFSETFPDATVHVVRNGYYGAPERFV
FT                   LYQDSKLRKSIEAKGRSLDFPELADRVADDLRSHRLSVRKAVETLPIGQRAELLRWRAC
FT                   YDAMFSQVTDDA"
     atgaacaaga cagtcgacat gacagtcaac accatctatc tcgtcggcgg tggcaagggc        60
     ggcgtcggca agagcgtggt cgcgctcgcg ctcgtggatc acctgcagcg ccggggcgtg       120
     aatactgtgc tggtggaaaa cgacacatcg aatcctgacg tgatgcgcgc agtacacgaa       180
     gagattgcgt gtgcatcgtt cgatctggac acggcgggcg gctggattga catggtgaac       240
     tattgcgacg ggcatcgcga tgcggtcgtg gtggtcagca cggcggcgcg taaccaggat       300
     ggggtcacgc gctacggcgc gacactgggc agcacactcg atgaactcgg gcgtcggctc       360
     gtcgtcttct gggtcatcaa ccggcagcgc gacagtctcg aactgctgcg gcagttcagc       420
     gagacgttcc cggatgcgac ggtgcatgtc gtgcgcaatg gctactacgg tgcgcctgaa       480
     cggttcgtgc tgtatcagga ttcgaagctg cgcaaaagca tcgaggcgaa gggccggtcg       540
     ctggattttc ccgagctcgc ggaccgggtg gccgatgatc tgcgcagcca ccggctgtcg       600
     gtacgcaagg cggtcgaaac cctgcccatc gggcagcgcg ctgaactgct gcgctggcgg       660
     gcgtgctacg acgcgatgtt ctcgcaggtg acggacgatg cgtga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page