(data stored in ACNUC7421 zone)

EMBL: CP000272.PE454

CP000272.PE454       Location/Qualifiers
FT   CDS_pept        complement(496940..497773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0478"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36382"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ7"
FT                   /protein_id="ABE36382.1"
FT                   /translation="MQLASSFRYGSPMLRSDSPLSDDQIRRVAPSIFADGKHESRSDRY
FT                   TYIPTIDVLRGLRNEGFQPFMVCQTRVRAQDKREFTKHLIRMRPASEITGEDVNEVILL
FT                   NSHDGSSGFQLLGGVYRFVCQNGMVAGETIGEVRVPHRGNIVQNVINGAFDVLDGFDLI
FT                   REQKDGMKAVTLDRDEQYAFARSALALRYDPSDTEAPAPVTESQLLAPRRFEDRRDDLW
FT                   TVFQRTQENLTKGGLHGRSRSGRSMSTRPITGIDQNVKLNRALWMLADAMRQMKS"
     atgcaactcg cttcctcctt ccgttacggt tccccgatgc tccgttccga ctcgccgctg        60
     tcggacgacc agatccgccg tgttgctccc tcgattttcg cggacggcaa gcacgaaagc       120
     cgctccgacc gctacaccta cattcccacc atcgacgtgc tgcgcggtct gcgcaacgaa       180
     ggcttccagc cgttcatggt gtgccagacc cgcgtgcgcg cccaggacaa gcgcgaattc       240
     accaagcatc tgatccgcat gcgccccgcg agcgaaatta ccggcgagga tgtcaacgaa       300
     gtcatcctcc tcaattcgca cgatgggtcc agcggattcc agttgctcgg tggcgtctat       360
     cgcttcgtct gccagaacgg gatggttgcg ggcgaaacca tcggcgaggt ccgcgtcccg       420
     cacaggggca acatcgtgca gaacgtcatc aacggcgcgt tcgatgtgct cgacggcttc       480
     gacctgatcc gcgaacagaa ggacggcatg aaagccgtca cgctcgatcg cgacgaacag       540
     tacgcgttcg cgcgctccgc cctcgcgctg cgctacgacc cgtccgacac cgaagcaccc       600
     gcccccgtca ccgaaagcca gttactcgcc ccgcgtcgct tcgaggaccg ccgggacgac       660
     ctgtggacgg tatttcaaag aacgcaggaa aacctcacca agggcggact gcatggacgc       720
     tcgcgcagcg gacgctccat gtccacgcgt cccatcaccg gcatcgacca gaacgtgaag       780
     ctcaaccgcg cgctgtggat gctggctgac gccatgcggc agatgaaatc gtaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page