(data stored in ACNUC7421 zone)

EMBL: CP000272.PE455

CP000272.PE455       Location/Qualifiers
FT   CDS_pept        498310..498573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36383"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ6"
FT                   /protein_id="ABE36383.1"
FT                   /translation="MGETACHAQPEAGAGLIVRGRSTRFASRVSPSGETAVPRITVAVP
FT                   VTGANGVTAWDESGDRAMAIAADERIPGGTAAGSSQGACLLQ"
     gtgggcgaaa cggcctgcca tgcgcaaccg gaagccggtg caggactcat cgtccgtgga        60
     cgttccacgc ggtttgcatc ccgggtcagt ccatcagggg aaactgccgt gccgcgtatt       120
     actgttgcgg tgccggtaac gggtgcgaac ggtgtgacgg catgggatga atcaggtgat       180
     cgcgcgatgg ccattgctgc tgatgagaga atccccggcg gcaccgccgc gggctcgtcg       240
     cagggcgcgt gcttgctaca atag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page