(data stored in ACNUC7421 zone)

EMBL: CP000272.PE46

CP000272.PE46        Location/Qualifiers
FT   CDS_pept        complement(53801..54112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0047"
FT                   /product="Putative ATP synthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35974"
FT                   /db_xref="GOA:Q13IW5"
FT                   /db_xref="InterPro:IPR011744"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW5"
FT                   /protein_id="ABE35974.1"
FT                   /translation="MSRSDEPDDNERLAHAARQARTRERRARDEPEPSLGNRLGQIGIL
FT                   GWSIVIPTLLGLAIGHWLDRHFGTGVFFSAPLLMIGAAFGLWSAWKWMHRQTRSKHHD"
     gtgagcaggt ccgacgaacc cgatgacaac gagcgcctcg cgcatgcagc aagacaggcc        60
     cgtacacgcg agcggcgggc tcgcgacgaa cccgagccat cgctcggcaa ccgtctgggg       120
     cagatcggca ttctcggctg gtcgatcgtc attccgacgc tgctcggcct ggccattggc       180
     cactggctcg accggcactt cggcacaggc gtgttctttt ccgcgccgct gttgatgatc       240
     ggcgccgcgt ttggcctgtg gtcggcgtgg aaatggatgc accggcaaac aaggagcaag       300
     catcatgact ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page