(data stored in ACNUC7421 zone)

EMBL: CP000272.PE467

CP000272.PE467       Location/Qualifiers
FT   CDS_pept        complement(509292..509606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36395"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP4"
FT                   /protein_id="ABE36395.1"
FT                   /translation="MPVADHSAIVAFETLKGRYQKAGRHLRFANIDTQSTCSQTRGCFR
FT                   YQRPTPVESQNLCGRCASKATLSKEACQTTELGRQNAVVKAEAAPGDVLIGGEAAVAVC
FT                   "
     ttgcccgtgg ctgatcactc cgcgatagtt gcattcgaaa cactgaaggg ccgctatcaa        60
     aaggccggaa ggcatttgcg atttgcgaac atcgacacgc aatcaacatg ttctcaaacg       120
     cgtgggtgtt tccgttatca acgtccgaca ccggttgaat cgcaaaacct gtgtggccgt       180
     tgtgcttcga aagcgaccct ttcgaaggag gcatgtcaaa caaccgagtt gggtcgacaa       240
     aacgcggtcg tgaaggcgga agcagccccc ggcgatgtgc tcataggcgg tgaggctgcg       300
     gttgcagttt gctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page