(data stored in SCRATCH zone)

EMBL: CP000272.PE469

CP000272.PE469       Location/Qualifiers
FT   CDS_pept        511957..512220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP2"
FT                   /protein_id="ABE36397.1"
FT                   /translation="MAVISAAEHEIPPVKKHSSKWRRIMTQRRCGERLKRSSATDVGPT
FT                   TAHVAAPLERIGRLFWNQPASHKSPDFYNSSLKKSDFSKIKK"
     atggctgtca tatcagccgc agagcacgaa ataccaccag taaagaagca cagttcgaaa        60
     tggcggcgaa tcatgacgca acgcaggtgc ggcgagagac tcaaaagatc ctccgcaacc       120
     gatgtcggcc cgactaccgc acacgttgca gcgccattag aacgcatagg gagattattt       180
     tggaaccagc ctgcatctca caaatcgcct gatttttata attcttcgct gaaaaagagt       240
     gatttttcaa aaataaaaaa gtag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page