(data stored in ACNUC7421 zone)

EMBL: CP000272.PE471

CP000272.PE471       Location/Qualifiers
FT   CDS_pept        513681..514931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0498"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36399"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP0"
FT                   /protein_id="ABE36399.1"
FT                   /translation="MLAELILVTKMAFLRRLFDCRISRHVLSLGVLILGIGTLLALPVM
FT                   AVEPFKIVGIVALSGTYGIYGDDMRKGLDLAVAQRKTVLGRPIQVVWEDTQSKADVASQ
FT                   KAIKAASSGADLIFGSVASSETLALEQISESRKIPLLITQSSADAITAKPHRYVFRTRE
FT                   KFSNEVLMVQHYIEKNKSASVYAVVADASVFRDGWTEIQHGLVADGVALKGDDVVPFGA
FT                   TDYSVVVGKAAASGANTLVLFLAGSDAVTFIKQAAAVRLMDHMRVVGPTIMDDSMAKAA
FT                   GDAALGVVSAVGYHHSIDNDANRKFVSEYRKSYSGIAPSFGAGEAYEGINWMLDVIERT
FT                   HSSDPAVWISAMEKSADPNSIEGAKRMRWCDHQADRVSYMVEGVKGSGAQPELKIIGAW
FT                   TDGELGQKPCPVGQGRP"
     atgctggctg aactcatttt ggtgacgaaa atggccttcc tgagaagatt atttgactgc        60
     cgtatctcac gacacgtcct ttcgctcggc gtgctgattt tagggatcgg caccttgctt       120
     gccctgccgg taatggcggt tgagcctttc aaaattgtgg gaatagttgc tttgagcggc       180
     acttatggga tttatggcga cgacatgcgg aaaggtctgg atctggctgt cgcacagcgt       240
     aaaaccgttt taggaagacc aatacaagtc gtctgggaag acacccaaag caaggctgac       300
     gttgcgtcgc agaaggctat caaagccgca tcttcaggcg ctgatcttat ctttggctcc       360
     gtcgcttcat ctgaaacgct cgcgctcgaa cagatcagtg aatcgcgaaa aattccacta       420
     ctgatcacac aatcatcagc agatgcaatc accgctaaac cacatcgcta tgtctttcgc       480
     acgagggaaa agtttagcaa cgaggttttg atggtgcagc actatataga aaaaaacaag       540
     tctgcctcgg tttacgcagt cgtagctgac gcatcagttt tccgcgacgg ttggacggag       600
     attcaacacg gcttggtcgc agatggtgtg gcattgaaag gtgacgacgt cgtgccgttt       660
     ggagcaaccg attattcggt tgtagtcggt aaagcggccg cctctggcgc aaataccctt       720
     gtgctattcc ttgcagggag tgatgccgtc acgtttatca agcaggccgc cgccgtgcga       780
     ctgatggacc acatgcgcgt tgtcgggccg accattatgg acgacagcat ggcaaaagcg       840
     gctggcgatg cagcgcttgg agtggtttca gcagtgggct atcaccacag catagacaat       900
     gatgcaaata gaaagtttgt cagcgaatat cgaaaatcct attccggaat tgcgccctcg       960
     tttggtgccg gggaggccta cgaaggtatt aattggatgc ttgacgttat cgaaaggaca      1020
     cactcgagcg atccggcagt ctggatctcg gctatggaaa aatcagctga cccaaacagt      1080
     atcgaaggcg ctaaacgcat gagatggtgc gaccatcagg cagacagggt gagctatatg      1140
     gttgaaggcg tgaagggatc gggagctcaa cccgagctaa agattatcgg tgcatggacg      1200
     gacggtgaac tgggtcaaaa accctgcccg gtcgggcaag ggcggccatg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page