(data stored in ACNUC7421 zone)

EMBL: CP000272.PE473

CP000272.PE473       Location/Qualifiers
FT   CDS_pept        515785..516729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0500"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36401"
FT                   /db_xref="GOA:Q13HN8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN8"
FT                   /protein_id="ABE36401.1"
FT                   /translation="MKIRYTGLIVVAVGLIAIGFQYLRGDGGAAFLVGLMLVWAIAALG
FT                   YDLVFGLSGLLSFGHAAFLGSGAYAVAILTTQWMLPFPVALFISAVLGALLALVFGAAA
FT                   LRASGIYCGLLTLALAQLTNILLTVRLQGLTGGDDGISGVSRPIKYLQFLTDDLNYVVY
FT                   VGCIFLGALALSALLRLSPFGQVLRAASQNEVRAEQLGWNVRRYRLAIFAVSGAYTGIA
FT                   GGLIAGLTQFAGPQLMQWSNSGDLIIMTLLGGRDSLLGPVVGVVLTILLREVVGSYTEH
FT                   WAGILGVVFVLCTLYMPVGVIGLWRNFRGKGAT"
     atgaagatcc gttacacggg cttaattgtt gtcgccgtcg ggctgatcgc cattggcttt        60
     cagtatctga gaggtgacgg tggtgcggca ttcctggtgg gattaatgtt ggtctgggcg       120
     attgcggcac tgggttatga cctggtgttt ggcctgagcg gtttgctgtc gttcggacat       180
     gctgcattcc ttggctctgg tgcctatgca gtcgcgattc tgactaccca atggatgctg       240
     cctttcccgg ttgccctttt tatttccgca gtcctgggag ccttgcttgc gctcgtcttt       300
     ggtgctgcgg cgttgcgggc tagcggaatt tattgcgggt tgctcacgct tgcgttggcg       360
     cagctcacaa atattcttct caccgtgcgg cttcagggat tgacgggagg tgacgatgga       420
     atttccggcg tgagcaggcc gattaaatac ctgcaattcc tgacggacga tctcaattat       480
     gtcgtgtacg ttgggtgcat ttttcttggt gcattggctt tatctgcctt gttacggcta       540
     tccccgtttg gacaggtttt gcgagcggca agtcagaacg aggtgagagc ggaacaactc       600
     gggtggaatg ttcggcgata cagattggcg atctttgccg tgtctggcgc ttatacgggg       660
     atagcagggg gactgatcgc cggtctgacg caatttgccg gacctcaact catgcagtgg       720
     agcaactcgg gtgacctcat cataatgacc cttttgggag gccgcgattc actcctgggt       780
     ccggtagtag gtgtagtttt gacgattctg ctccgtgagg tggttggttc atacaccgag       840
     cattgggcag gcatcctggg cgtcgttttc gttctctgta cgctatatat gcccgtcggc       900
     gtcatcgggc tctggagaaa ttttcgtgga aaaggcgcta catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page