(data stored in ACNUC7421 zone)

EMBL: CP000272.PE478

CP000272.PE478       Location/Qualifiers
FT   CDS_pept        520895..521296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0505"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36406"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:2O8Q"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN3"
FT                   /protein_id="ABE36406.1"
FT                   /translation="MKLQTTIQHEPKDGSGFDRGLREFFEYRDTGVNEATGGMFGAHVI
FT                   RAIPGKEAKPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVMLEAGGSAFQPPGVRHRELR
FT                   HSDDLEVLEIVSPAGFATSVVDLEEARKP"
     atgaagcttc agaccacaat ccagcatgaa cccaaagacg gcagcgggtt tgatcgcggc        60
     cttcgcgagt tcttcgagta ccgcgacact ggcgtgaacg aggcgactgg cggaatgttc       120
     ggcgcgcacg ttatccgcgc cattcccggc aaggaggcca agccgacctg gcatacccat       180
     accgtcggat ttcagctgtt ctacgtcttg agaggctggg tcgagttcga atacgaggac       240
     atcggcgcgg tcatgcttga ggccggcggc tcggctttcc agccgcccgg ggtgcgccac       300
     cgggaattgc gccatagcga cgatctggag gtgcttgaaa ttgtgtcgcc tgccggcttc       360
     gcgacaagcg tggtcgatct ggaggaggcg cgaaagccat ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page