(data stored in ACNUC7421 zone)

EMBL: CP000272.PE479

CP000272.PE479       Location/Qualifiers
FT   CDS_pept        521293..521673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36407"
FT                   /db_xref="GOA:Q13HN2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN2"
FT                   /protein_id="ABE36407.1"
FT                   /translation="MTMMYDWNRLPREVVRPGVERCGFRGDDSILVMNWISPAIDVRPH
FT                   QHEFEQLVVCVQGSFNYHVGDRVFHMAPGCMLRVPPRTVHYIEPVGHEVALNLDIFAPM
FT                   RDDYRHLVEYQAGEFPGNRGNA"
     atgaccatga tgtatgactg gaaccggctg ccgcgcgagg tggttcgtcc gggcgtggag        60
     cgttgcggtt ttcgggggga cgacagcatc ctcgtgatga actggatttc gccggccatt       120
     gacgtacgcc ctcatcagca cgaattcgag caactggttg tgtgtgtcca aggcagtttc       180
     aattaccacg taggtgaccg ggtgttccac atggcgcccg gatgcatgct gcgggtgccg       240
     ccccggaccg tgcattacat tgagccggtc ggccatgaag tagctttgaa cctggacatc       300
     tttgcgccga tgcgcgacga ctacaggcac ctcgtagaat accaggcggg tgaatttccg       360
     ggcaacaggg gcaacgcgtg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page