(data stored in ACNUC7421 zone)

EMBL: CP000272.PE482

CP000272.PE482       Location/Qualifiers
FT   CDS_pept        524119..524673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36410"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM9"
FT                   /protein_id="ABE36410.1"
FT                   /translation="MISTQREIVVQQPPAQAWIFVREIGNWAAQMPGYLKHEEKGPDDS
FT                   VWTLDIHLGPFSRPVELSVHVVRWLPGEGADFRLKATYEPFHGEGSFRLTAVPGGTNMV
FT                   MILGTEVTGSMSKLLTAMAAPVLEKVADEFSRNLVAVLGGAPELASPSDRPAQNDTRTS
FT                   IVSAFRGWLVGIHRRLTRAKT"
     atgatctcca cccaacgcga gatcgttgtc cagcagccgc ctgcgcaggc ctggatcttt        60
     gtcagggaga tcggcaactg ggctgcgcag atgcctgggt atttaaagca tgaggaaaag       120
     gggccggacg attccgtgtg gacgctcgat atacacctcg gccctttctc gcgacctgtt       180
     gagctgtcag tgcacgtggt gcgctggctg ccgggagaag gcgcggactt caggctgaag       240
     gcaacttacg aacccttcca cggcgaaggc tcgtttcgtc tgactgctgt gcccggcgga       300
     acgaacatgg tgatgattct cggcacggag gtcactggct cgatgagtaa attgttgacg       360
     gcgatggcgg ctccggtcct cgaaaaggta gccgacgagt tttcacgaaa cctggtggcg       420
     gttctgggag gggcgcctga gctcgcctcg ccgtctgacc ggcccgcgca aaatgatacc       480
     cgtaccagca ttgtctctgc gtttcgcgga tggctggtgg ggattcaccg ccgcctgacg       540
     agggcaaaaa cctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page