(data stored in ACNUC7421 zone)

EMBL: CP000272.PE483

CP000272.PE483       Location/Qualifiers
FT   CDS_pept        524735..525166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0510"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36411"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM8"
FT                   /protein_id="ABE36411.1"
FT                   /translation="MKDETNQEARPVRPHPVMTMDTEFFWNAAREHKLAIQRCCNCGKL
FT                   RHPPMPSCPHCYSFEWDTVESAGNGTLLSYTVVYAPLVTPFTKPYAVGLVALDEGTRLV
FT                   AELVDANFDELRIGMPAMLDFMDCEGDLTLPVFRVQRER"
     atgaaagacg aaacgaatca ggaggccagg ccggtgcgcc cgcatccggt gatgaccatg        60
     gatactgagt ttttctggaa tgccgcacgc gagcacaagt tggcgatcca gcgctgctgc       120
     aattgcggga agttgcgcca tccgccgatg ccctcgtgtc cccactgcta ctcgttcgag       180
     tgggacaccg tcgaatcggc tggcaacgga acactcctaa gctacacggt ggtgtacgcc       240
     ccccttgtga cgcccttcac gaagccctat gcggtagggc tggtcgccct cgatgaagga       300
     acccgtctgg tggcggaact ggtcgatgcg aacttcgacg aacttcggat tggcatgcct       360
     gccatgcttg atttcatgga ctgtgaggga gacctcacgt tgcccgtctt ccgcgtgcag       420
     cgggagcgct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page