(data stored in ACNUC7421 zone)

EMBL: CP000272.PE485

CP000272.PE485       Location/Qualifiers
FT   CDS_pept        526388..527368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36413"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM6"
FT                   /protein_id="ABE36413.1"
FT                   /translation="MGADYASAVSYTRTGSGDDLPDWVGREFVIHAPFPVESSRIADFC
FT                   AMLEDPNPLYWDIEAATQKFGRPIAPPATLTAWRWPAPWNPYGRPEHGFPATVEVPCPT
FT                   DTLVNVEFACEYLQQIGVGDKLTYVDRIAAISDEKMTALGRGYFVTADTVVTNQENQEV
FT                   ARYRNVMLRYKSGTGKAADSQKVQQPAPEKVPTDSERPIPALSIPVTWTLCTQLTAATR
FT                   DYFPGHHDPDYARSQGVLNPYPNTGYYCGLMDRVALEWANFDGVLKRRVLRMFTPAPIG
FT                   TTLRTSGRVLSRQTVEGTEHVELQIEVRNEEALIAQARITLKMGA"
     atgggagccg attacgcttc tgcagtgagt tatacccgaa cgggaagcgg cgacgatttg        60
     ccggattggg tggggcgcga attcgtgatc cacgccccat ttcccgtgga gtccagccga       120
     atcgccgatt tttgcgccat gctggaagac ccgaaccccc tctattggga tattgaggca       180
     gcaacgcaga agtttggccg accgatcgcc cctcctgcga ctctgacagc ctggcgatgg       240
     ccggcaccct ggaatcccta cggccggccc gagcacgggt ttcccgccac ggtcgaagtg       300
     ccatgtccca ccgatacact ggtgaacgtc gagtttgcct gcgaatacct gcagcagatc       360
     ggtgtcggcg acaagctgac ctacgtggac cgcatcgccg cgatttccga cgaaaagatg       420
     accgcgctgg gaaggggcta cttcgttacc gcggacacgg tggtcaccaa tcaggaaaac       480
     caggaggtcg cgaggtaccg caacgtcatg ctgcggtaca aaagcgggac tggcaaggcc       540
     gctgatagcc agaaagtgca gcagccagcc ccagagaaag tcccgaccga cagcgagagg       600
     ccgatcccag ccttgagcat tcctgtgaca tggaccctgt gcacacaatt gacggccgcc       660
     actcgagatt acttcccggg gcaccacgat cccgactacg ccaggtcgca gggtgtctta       720
     aatccttatc cgaacaccgg ttattactgc gggctgatgg accgggtggc gctggaatgg       780
     gcaaatttcg acggcgtgct gaagcggcgg gtgctgcgaa tgttcacacc tgcaccaatc       840
     ggcaccactt tgcgtaccag tgggagagtt ctctcgcgtc agactgtgga aggtacggag       900
     catgtggaac tgcagatcga agtccggaac gaagaagcgc tcatcgccca ggcgcgcata       960
     accctcaaga tgggagcttg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page