(data stored in ACNUC7421 zone)

EMBL: CP000272.PE487

CP000272.PE487       Location/Qualifiers
FT   CDS_pept        528575..529777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0514"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36415"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM4"
FT                   /protein_id="ABE36415.1"
FT                   /translation="MIYGIRNAIAALMLGVTFPCMAQISENVIRIGVLTDLSGPYMDVD
FT                   GPGGVEAIRMAIADAGGTIDGRRIELLVADHQNRTDLAVSKAREWIDTRGVDVIFAGGA
FT                   SAAVLGMAQVAKEKKKPLIVNGAGSARLTNEDCSPYTVHYAYDTVALAKVGGAALVRQG
FT                   LKSWFFVALDTAFGASTVSDTSEVLRANGGKVIGVVRHPVNLPDFSSIMLQAQGSGAQV
FT                   LALANAGSDAVNAIKSAKEFGVMRSMKVAGLNLFIGDVYSFGLPTAQGLYLTENWYWDI
FT                   SPESRAWSKRFFEKMKKMPAGTQAAQYSAASHYLAAVKETRSDDGDKVMAAMKSMPIND
FT                   MYAKNGRIRADGRMIHEMYLMQVKTPAESHYPWDYYRIAERVPAEEAFTTKAQSKCPLW
FT                   K"
     atgatttacg ggatcaggaa tgctatcgcc gcattgatgc tgggcgtgac gtttccctgc        60
     atggcccaaa tctcggaaaa tgtcatcaga ataggggtgc ttaccgatct atcgggaccc       120
     tacatggacg tagatggtcc gggaggagtc gaggctatcc gcatggccat cgccgatgct       180
     ggcggcacca ttgacggcag aaggatcgaa cttctggttg cggaccatca gaacaggacg       240
     gatctcgccg tctcaaaggc ccgcgaatgg atcgacacgc gtggcgttga cgtcatcttc       300
     gcgggtggtg cgtcggcagc cgtgcttggg atggcacagg tcgccaagga aaagaaaaag       360
     ccgctgatag tgaacggcgc cggcagtgcg agactaacaa atgaggactg ctcgccgtac       420
     accgtgcact atgcttatga cacagttgca ttagcaaaag tcggcggtgc cgcgcttgtt       480
     aggcaaggcc tgaagtcctg gttttttgtt gcgcttgata cggcgttcgg cgcatccaca       540
     gttagcgaca cctccgaagt actgcgggcc aacggcggaa aagtcatcgg agtagtcagg       600
     catcctgtga acctccctga cttttcgtcg atcatgcttc aggcccaagg ttctggggcg       660
     caggttctgg ctctggcgaa cgccggctcc gatgcggtga acgcaatcaa gagcgcaaag       720
     gaattcggcg ttatgcggag catgaaggtg gcggggctaa acctgttcat tggggacgtg       780
     tactccttcg gcctccctac ggcccaaggc ttgtacctga cggaaaactg gtactgggac       840
     atctcgccag agtcccgtgc ctggtcaaaa cgcttcttcg agaagatgaa aaagatgccg       900
     gctggcaccc aggccgcgca gtactccgca gcttctcact atcttgccgc tgtgaaggaa       960
     acaaggtcgg atgatggcga caaggtgatg gcagccatga agtcgatgcc gatcaacgac      1020
     atgtacgcaa aaaacggaag gattcgcgcg gacggcagga tgatccacga gatgtatctc      1080
     atgcaggtta agacgccagc ggagtctcat tacccgtggg attactacag gatcgcggag      1140
     cgcgtgcccg cggaggaagc gttcaccacg aaggcacagt cgaagtgccc tctgtggaaa      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page