(data stored in ACNUC7421 zone)

EMBL: CP000272.PE49

CP000272.PE49        Location/Qualifiers
FT   CDS_pept        complement(56010..56783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0050"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35977"
FT                   /db_xref="GOA:Q13IW2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW2"
FT                   /protein_id="ABE35977.1"
FT                   /translation="MNGIIDLSGKRGLVVGIANEHSIAAGCARMFRAIGAEIAVTYLND
FT                   KAEPYVRAVAETLPASLVMPCDVTVPGQLEAVFARISREWGKLDFVLHSIAFAPAVDLH
FT                   ASLVDCSAEGFALAMDVSCHSFIRMTRLALPLMAEGGSLMTVSFYGAERAVDHYNLMGP
FT                   VKAALESSVRYLAVDLAPRRVHVHAISAGAVKTRAASGLDHFDVLLDEVRARTPARHLV
FT                   TIDEIGRIAAVLASDAGMTLTGSTLYADAGFHVVA"
     atgaacggca tcatcgattt atccggcaag cgcggactgg tcgtcggcat cgccaacgag        60
     cacagcatcg ccgccggttg cgcgcgcatg ttccgcgcca tcggcgccga gatcgccgtc       120
     acctatctga acgacaaagc cgagccttat gtgcgcgccg tcgccgaaac gctgccggcg       180
     agcctcgtga tgccctgcga cgtgaccgtg ccgggccagc tcgaagccgt cttcgcgcgc       240
     atcagccggg agtggggcaa gctcgacttc gtgctccact cgatcgcctt cgcacccgcc       300
     gtcgatttgc acgcgagcct cgtcgattgt tccgccgagg gtttcgcgct cgcgatggac       360
     gtgtcgtgcc attcgttcat ccgcatgacg agactcgcgt tgccgctgat ggccgaaggc       420
     ggcagcctga tgaccgtgag tttctacggt gccgagcggg cggtcgacca ctacaatctg       480
     atgggtccgg tcaaggcggc gctcgaatcg agcgtgcgtt atctggcggt ggatctcgcg       540
     cctcgccggg ttcatgttca cgccatttcc gccggtgccg tcaaaacccg cgcggcgtcc       600
     gggctcgatc atttcgatgt gctcctcgac gaagtccgcg cgcgcacgcc ggccagacac       660
     cttgtcacga tcgacgaaat cggccgcatc gcggctgtgc tcgccagcga cgccggcatg       720
     acgctgaccg gctcgaccct gtacgccgac gccggctttc acgtggtggc ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page