(data stored in ACNUC7421 zone)

EMBL: CP000272.PE491

CP000272.PE491       Location/Qualifiers
FT   CDS_pept        533037..533594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0518"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36419"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM0"
FT                   /protein_id="ABE36419.1"
FT                   /translation="MTAERKHLHSRCITCEAYLCEDGSVELEGMLTDTKSHPFNVGDQG
FT                   VLPTGHPVHQMLVRLRVASDFRITEAEARTIHGPYRVCGDIAPQYSKLVGLTIGPGFNA
FT                   LVKRMFRERLGCTHLTELLPVIATVAYQAIWSEFRSFEKFDPANAAERRSTPLGGCHAL
FT                   QPDGEVVRLHFPDRYKPPDPSA"
     atgacagctg agcggaagca tctccattcg cgctgcatca cgtgtgaagc gtacttgtgc        60
     gaagacggtt cggtcgagct tgagggcatg ctgacggata ccaagtccca ccccttcaac       120
     gtgggtgatc aaggcgtgct gccgacaggc catccggtcc accagatgct cgtgcgcctc       180
     cgtgtggcct cggatttccg aatcaccgag gcggaggcac gcacgattca tgggccgtac       240
     agggtgtgcg gtgatattgc accccaatac agcaaacttg tcggcctgac catcgggccc       300
     ggcttcaatg ctctggtgaa gcgaatgttc cgggaacggt tgggctgcac gcatctgacc       360
     gaacttctgc cggttattgc cacggttgct tatcaggcga tctggtcgga gtttcgcagc       420
     ttcgagaaat tcgaccctgc caacgcggcg gaacgacggt ccaccccgct cgggggctgc       480
     catgcactcc aaccggatgg ggaagtggtg cgcctgcatt tccccgaccg ctataagccg       540
     cccgacccct ccgcctag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page