(data stored in SCRATCH zone)

EMBL: CP000272.PE493

CP000272.PE493       Location/Qualifiers
FT   CDS_pept        535106..539140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0521"
FT                   /product="Multi sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="contains CheB and CheR domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36421"
FT                   /db_xref="GOA:Q13HL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL8"
FT                   /protein_id="ABE36421.1"
FT                   /translation="MNDASNISPTPGAATGPRIVAIGASAGALHALSLFFRAACTIPHD
FT                   IAFAVVVHLAPGAESHLPELLAKDTSFAVSAIEDGATLRPGHVYVIPPKVSVVIEQGAF
FT                   RLRPAVERPTIPMPIDAFFTSLATDQHDRAIGIVLTGANADGSAGLRAIKAAGGMVMAQ
FT                   APETAEHDSMPTHAIATGLVDYVLPVEKMPAVLFDYIARSTEEMSSVSGKLEVQTDLEP
FT                   VLRALAAAGSDFRGYKRGTLGRRIARRMAVNQVDSLDAYCEILRTSVEEAQALSLDMMI
FT                   GVTEFFRDPEAWKALAERVVDSLLGEQKGDQPLRIWVPGCATGEEAYSMAMLLTEEIEK
FT                   RKITRSFMILASDVNRIALARARQGIYPPGVALPVGEERLERFFRAHGDGYQIDQALRE
FT                   TILFTPQNLIADPPFSRVDLISCRNLLIYLEPAAQQRVFEVFHFALNPKRYLFLGRSES
FT                   TDPDSSQFQEVSRTWRIYQRSPAATAVVSGYRFSATGGRREEFPSASRGGARSKGYAEL
FT                   VNGTLLAEHHAASVLINSAHQVLYVSGSTDEYLRQPAGEPTGNILDMAREGLRLKLRIV
FT                   LRRATQDQTVSPVSEVVSDGGAPGVKITVTQPFDTAHTGKALLVVFARVAVADRPASLA
FT                   PTGVDSDLWHLESELRTTQVELGSTIEELEESNSELRVSNEEILSMNEELRSANEELET
FT                   SKEELQALNEQLNVVNSQLGQKVHELEMLSEDVTNLLASTEIATLLLDGHAVIKRFTPR
FT                   AARIFGLALADIDRPITNVLGNPLGDALLEDVQRVLSAQTGQAEKEIETVTGEWYVRRI
FT                   TPYIAVKGASPAGVVVTWNDITHVKASDERSRRLAAVVQDSNDAMTVFDLNGRLMAWNR
FT                   AATAMYGYTEAEALGMTVSDMLPPGARQDHLDFIRYAAHNEALHSYETQRVTKGGRVVD
FT                   IWITLSILSDDQGHAVAIATTERELTDRSLSNAQLRERAERLAQADRRKNEFLAMLGHE
FT                   LRNPLAALCSSGDLLASETIDPRQKSWAVGVIQRQGRSMTQLVNEMLDLTRITSGSIEL
FT                   RRQAVTLKAVIQSAVEVCQPIIDERHHTLSVSLPDEPVLMYVDPTRLSQVVENIVINAA
FT                   RYTEPGGHISLTATRTGRRLSLRVKDNGRGIPASMLSTLFDMFVQGPVPYGQLHNGLGV
FT                   GLSVVRRLVELHGGSVRAISDGRTGSEFIVDLPLGMIPPGVEQAGTPQEPVNAGPRKIL
FT                   IIDDNADASEALAMLLAAEGHVVETRLDGPGGLEAASTFRPDVVLLDIGLPGMDGYEVA
FT                   KQLRDSVATYDTMLIAVTGYGQPGDQLRSAEAGLDYHLVKPVDINALTRLLAVQVKPRG
FT                   R"
     atgaatgatg ccagtaatat ttctccgaca cctggagctg ctactggtcc ccggatcgtc        60
     gccatcgggg catcagccgg tgcgcttcat gcgttaagcc tattttttcg tgcggcttgc       120
     acgatcccac acgacattgc cttcgcggtc gtggtacatc tggcgcccgg cgccgaaagt       180
     cacctcccgg agttgctggc caaagatacg tcttttgccg tgtcggccat cgaggacggc       240
     gcgacgctgc ggccggggca cgtctatgtt atcccgccga aagtgtccgt cgttatcgag       300
     cagggcgcgt tcaggctgcg gcccgcggtt gagcgtccga cgattccgat gccgatcgac       360
     gcgttcttca cgtcgctggc caccgaccag catgatcgcg cgatcggcat cgtgctcact       420
     ggtgcaaacg cggacggttc ggcgggcctg agagccatca aggctgctgg tggaatggtg       480
     atggcgcaag cgccggagac ggccgaacac gattcaatgc ccacgcatgc gatcgccacc       540
     gggctggtcg actacgtgct gccggtcgaa aaaatgcccg ctgtactgtt tgattacatt       600
     gcgcgttcca ccgaagaaat gtcgtcggtg tcaggcaaac tcgaggtaca gaccgatctc       660
     gaaccggtgc tccgggccct ggcggctgcc ggctctgatt tcagggggta caaacggggc       720
     actctggggc gtcgcattgc ccggcgcatg gcggtcaatc aggtggacag ccttgacgcg       780
     tattgcgaga tcctgaggac ttcggtcgag gaagctcagg cactgagtct ggacatgatg       840
     atcggcgtga cggaattctt tcgcgatccc gaggcgtgga aggccctggc tgaacgcgtc       900
     gtggacagtc ttctcggcga gcagaaaggc gatcagccgc tgcggatctg ggtacccgga       960
     tgtgcaacgg gggaggaggc ctattcgatg gccatgctgc tcacggagga gatcgagaaa      1020
     cgcaagatca ctcgatcctt catgattctt gcatccgatg tgaaccggat agccctcgcg      1080
     cgtgcccgcc agggcatcta tccgccgggt gtcgcgttac ccgtcggtga ggagcggctc      1140
     gaacgctttt tccgcgcaca cggcgatggc tatcagatcg accaggcgct gcgcgaaacg      1200
     atcctgttca caccacagaa cctgattgcc gatccgcctt tttcccgcgt cgacctgatc      1260
     agttgccgca acctgctgat ctacctcgaa cccgcagcgc agcagcgtgt gttcgaggta      1320
     ttccattttg cgctcaatcc gaagcgctat ctgtttctgg ggcgatcgga gagcaccgat      1380
     ccggactcca gccagtttca ggaagtctcc aggacctggc gtatctacca gcgcagtccg      1440
     gccgccacag cggttgtgtc cggctaccgg ttctccgcca cagggggaag gcgagaggaa      1500
     tttccgtccg caagccgtgg cggagcccgt agcaaggggt acgcagaact ggtcaacggc      1560
     accctgcttg cagagcacca cgcagcatcg gtgctgatca attccgctca ccaggtgctc      1620
     tatgtgagcg gttcgaccga cgagtacctg agacaacccg ctggcgagcc gacgggcaac      1680
     attctcgaca tggcgcgcga aggcctacgt ctgaagttgc ggatcgtctt gcgccgcgcg      1740
     acccaggatc agactgtttc gccggtcagc gaggtcgtat cggacggggg ggcccctggg      1800
     gtgaagatta cggtgaccca gccattcgac acggcgcaca cgggcaaagc gttgctcgtc      1860
     gtcttcgcaa gggttgcggt ggccgaccgg cctgcttcgc tggcgccaac cggcgtggac      1920
     tccgatctct ggcatctgga gagcgaactt cgcaccacgc aggttgagct tggcagcacg      1980
     atcgaggaac tggaagaaag caatagcgaa ttgcgagtgt cgaacgagga aatcctttca      2040
     atgaacgagg agttgcgctc ggcgaatgaa gaactcgaga catcgaaaga agaactgcag      2100
     gcccttaacg agcaactgaa tgtggtcaat tcccagcttg ggcagaaggt ccacgagttg      2160
     gagatgctca gcgaagacgt gacgaatctt ctagccagca cagaaatcgc gaccttgctt      2220
     ctcgacgggc acgcggtgat caaacgtttt actccgcgtg ccgcgcggat tttcggtctg      2280
     gcgttggcag atatcgaccg cccgatcacg aatgttctgg ggaatcctct gggcgatgcg      2340
     ctgctggagg atgttcaacg ggtactgtca gcgcagaccg gccaggcaga aaaggaaatc      2400
     gaaacggtga ccggagagtg gtacgttcga cgcatcacgc cgtatatcgc ggttaaggga      2460
     gcatcgcccg caggggtggt ggtgacgtgg aacgatatca cccatgtgaa ggcgtccgac      2520
     gagcggtccc gccgtcttgc cgcggtcgtc caggattcga acgatgccat gacggtgttc      2580
     gatctgaacg ggcgtctgat ggcctggaac cgggccgcga ccgcgatgta cggttatacc      2640
     gaagccgaag cgctgggcat gacggtgtcc gatatgctgc caccgggcgc cagacaggat      2700
     cacctcgatt tcatccgtta cgccgcccac aacgaggcac tgcattccta tgaaacacag      2760
     cgggtcacga aaggcggtcg cgtggtcgac atctggatca ccctgtcgat tctctcggac      2820
     gatcagggtc atgccgtggc tattgccacg acggagcgag aactcactga tcgcagcctg      2880
     agcaacgccc agcttcggga gcgtgccgaa cgcctggcgc aggccgaccg gcgaaagaac      2940
     gaatttctgg cgatgcttgg acacgaactg cgtaatccgc tcgctgccct gtgttcctct      3000
     ggagatttgc tcgcctcgga aaccatcgat ccgcgacaaa agtcctgggc cgtcggcgtc      3060
     atccagcggc aaggtcgatc gatgacgcaa ctggtcaacg agatgctgga tctcacgcgt      3120
     attacgagtg gcagcataga gttgcgtcgt caggcggtca cgctgaaagc ggtcatccag      3180
     agcgcggtcg aggtttgcca gccgattatt gacgaacggc atcacacctt gtcggtgtcg      3240
     ctaccggacg agccggtgtt gatgtacgtc gaccccaccc ggctatcgca ggtcgtcgaa      3300
     aacatcgtga tcaacgcagc caggtacacg gaacctggcg gccatatcag tctcacagcg      3360
     acaagaaccg gccgtcggct ttcgcttcgt gtcaaggaca acggaagggg aattcctgct      3420
     tcgatgctca gcacgctttt tgacatgttc gtccaggggc cggtgcccta cggtcagctt      3480
     cataatgggc tgggagtcgg cctgtccgtg gtccggcggt tggttgagtt acatggcgga      3540
     tcggttcggg ccatcagtga tggcaggaca ggtagcgaat tcatcgtcga tcttccgctg      3600
     ggcatgatcc cgcccggcgt ggaacaggcc ggtacaccgc aggaaccggt caacgcgggt      3660
     ccgcgcaaga tactcatcat tgacgacaat gccgacgcga gcgaggccct ggccatgctt      3720
     ctggcggcgg aagggcatgt ggtggagaca cggctggatg gccccggggg gctcgaagcc      3780
     gcttcgactt tcaggccgga cgttgtgctc cttgacatcg gattgcccgg catggacggc      3840
     tatgaggtgg cgaagcagtt gcgcgactct gtggccacgt acgacacgat gctgatagcc      3900
     gtcaccggct acgggcaacc aggcgaccag ctcagatccg cagaggcggg acttgattac      3960
     cacctggtca agccagtgga tatcaacgcg ttgacgcgtc tgcttgctgt gcaggtgaaa      4020
     ccccgcggca gataa                                                       4035
//

If you have problems or comments...

PBIL Back to PBIL home page