(data stored in ACNUC7421 zone)

EMBL: CP000272.PE496

CP000272.PE496       Location/Qualifiers
FT   CDS_pept        541303..542472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0524"
FT                   /product="Putative NAD(P) transhydrogenase alpha-1 subunit"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36424"
FT                   /db_xref="GOA:Q13HL5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL5"
FT                   /protein_id="ABE36424.1"
FT                   /translation="MYINVAVLTETRAHERRVALVPSVAQKLIKLGARLHMQPGAGAAI
FT                   HLDDAAFENVAFIADRTALVKDADVVLAVQPPALDVVSAMKEGAILVSFIYAHHEPALV
FT                   KRLLEKKITCFAMERVPRITRAQAMDALSSQSALAGYYAVQLGSTHLARVVPKVTGAAG
FT                   SIGPARVLVMGLGVAGLEAIATAHRLGAIVEGYDVRPETREQALSLGATFVDTGVDARG
FT                   KGGYARELHADEKIKVAAVLTKHIQSADLIITTAAIPGKASPKLISHTQVLGMKAGAVI
FT                   VDLSAEGGGNCDDTRPGETAQIGQITIVAPLNVPSLLGEDASELYAKNQYSLLALMMKD
FT                   NVIEIDWSDEVLARTVLTHAGENKAEADGKTMKVATPPASAPAVAPTQA"
     atgtatatca acgttgccgt gctgacggag acccgggcac acgagcgccg cgtggcgctc        60
     gtgccttccg tggcccagaa actgatcaag ctgggggccc ggctgcacat gcagccgggg       120
     gcaggcgcag ccattcatct ggacgatgcc gcgttcgaga acgtggcctt catcgccgat       180
     cgcactgccc tggttaaaga cgccgacgtc gtgctcgccg tgcagccacc cgcactcgat       240
     gtggtcagcg cgatgaagga gggtgcgatc ctcgtctcat tcatctatgc gcaccacgaa       300
     cccgcgctcg tgaagcgttt gctcgaaaag aagatcacgt gtttcgcgat ggagcgcgtg       360
     ccgcgcatca cacgtgcgca agctatggat gcgctgtcga gccagtctgc gctggcgggc       420
     tactacgcgg tgcaattagg ctcgacgcat cttgcgcgcg tggtgcccaa ggttaccggc       480
     gcggcgggct cgatcggccc cgcccgcgtg ctggtcatgg gccttggtgt ggcggggctg       540
     gaagcgattg ccaccgccca caggcttggc gcaatcgtcg agggctacga tgtgcgcccc       600
     gaaacccggg agcaggcgct ttcgctgggc gccacgttcg tcgataccgg tgtcgacgca       660
     cgcggcaagg gcggctatgc gcgcgagctg cacgccgatg aaaagatcaa ggttgcagcc       720
     gtgctcacga agcacatcca gagcgcggac ctgattatca cgaccgccgc cattcccggc       780
     aaggcttctc cgaaactcat cagtcacacg caggttctgg gcatgaaggc cggcgcggtg       840
     atcgtcgatc tgtccgccga gggaggcggc aactgcgatg acacacggcc gggggagacc       900
     gcgcaaatcg ggcaaataac catcgtggca ccgctgaacg tcccttcgct gcttggcgag       960
     gatgcgagcg aactgtatgc gaaaaaccag tacagcctgc tcgcattgat gatgaaagac      1020
     aacgtcatcg agatcgactg gagtgacgaa gtcctcgccc ggacggtcct gacacatgcg      1080
     ggcgagaaca aggccgaggc ggacggcaag acgatgaaag tcgccacccc tcccgccagt      1140
     gcgccagcgg ttgcaccgac tcaggcgtga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page