(data stored in ACNUC7421 zone)

EMBL: CP000272.PE50

CP000272.PE50        Location/Qualifiers
FT   CDS_pept        complement(56780..57973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0051"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35978"
FT                   /db_xref="GOA:Q13IW1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW1"
FT                   /protein_id="ABE35978.1"
FT                   /translation="MNDPLLLTFNPGSSTVKIGLFSVSAERATRIGQGSIDFRHAPLSL
FT                   HLVDGGGTREIALKAVVTEHLHEVLDETLNWFATHFSLTDLVSVGHRVVHGGDRFAGPA
FT                   EITDATLASIVELVPLAPLHQPQSVRLIRAIRHLRPNLAQSASFDTAFHRTQTELVRRF
FT                   ALPRHFFDSGVKRYGFHGLSYRFIAGALTRRFPLLAHSKVIAAHLGSGASLCAMSAGAS
FT                   RDTSMGFSTLDGIPMATRCGALDAGVVLHLLGQPGMTPDALEKILYEQSGLLGVSGISA
FT                   DSRELAASTQPQAQEALDLFVLRIAGEAARLATTLGGLDCLVFTAGIGEHQPPIRAAVC
FT                   KALAWLGVELDDAANARNAAVISSSASRVAVLVIATDEEQVIADETVSILHSQGATA"
     atgaacgacc cgctcctgct gaccttcaat cccggttcgt cgaccgtcaa gatcggtctg        60
     ttcagcgtct cagccgagcg cgcgacacgt atcggccagg gctcgatcga cttccggcac       120
     gccccgctat cgctgcatct cgtcgatggc ggcgggactc gcgagattgc gctcaaggcg       180
     gtcgtcaccg aacacctgca tgaggtgctg gacgaaacgc tgaactggtt cgcgacgcat       240
     ttttcgctta ccgatctggt ctcggtcggg catcgcgtgg tgcatggcgg cgaccggttc       300
     gccggacccg ccgagatcac cgatgccacg ctcgcgagca tcgtcgagct tgtaccgctg       360
     gcgccgctgc atcaaccgca gagcgtgcgg ctgatccgcg ccatccgcca cctgcggccc       420
     aatctcgcgc agtcggcatc gttcgacacg gcctttcatc gcacgcaaac ggagcttgtg       480
     cgccgcttcg cgctgccgcg ccatttcttc gacagcggtg tcaagcgata cggctttcac       540
     ggcctctcat accggttcat tgccggcgcg ctcacgcgcc ggttcccgct gcttgcgcac       600
     agcaaggtga ttgccgcgca cctgggcagc ggcgccagcc tgtgcgcgat gagcgcgggc       660
     gcaagccgcg ataccagcat gggcttttcg accctcgacg gcattccgat ggccacgcgc       720
     tgtggcgcgc tcgacgcggg cgtggtcctg cacctgctcg ggcagccggg catgacgccg       780
     gacgcgctcg aaaaaatcct ctacgaacag tccggcttgc tcggcgtttc gggaatcagc       840
     gcggacagcc gcgagcttgc ggcaagcacg cagccgcagg cacaagaggc gctcgacctc       900
     tttgtcttgc ggatcgcggg cgaagccgcg cggctcgcca ccacgctcgg cgggctggac       960
     tgcctcgtat tcaccgccgg catcggcgaa caccagccgc cgatccgggc agcggtatgc      1020
     aaggcactcg cgtggctcgg cgtggagctc gatgacgcag cgaacgcgcg caatgcggct      1080
     gtcatcagct cgtcggccag ccgcgtcgcc gtactggtta tcgcgaccga cgaggagcag      1140
     gtcatcgcgg atgagaccgt ctcgattctt cacagccagg gagcaacggc atga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page