(data stored in SCRATCH zone)

EMBL: CP000272.PE500

CP000272.PE500       Location/Qualifiers
FT   CDS_pept        545418..547250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0528"
FT                   /product="NAD(P)-dependent nickel-iron dehydrogenase
FT                   flavin-containing subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36428"
FT                   /db_xref="GOA:Q13HL1"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL1"
FT                   /protein_id="ABE36428.1"
FT                   /translation="MAVEPDLQLSPGPASLKSGSVDALLLRARHDPHALVQILREAQAR
FT                   HTWLSRELLGYIAGALGLTLAHVEGVATFYRFFHTSPAGEYRVLFSDNITDRMQGNAAL
FT                   LDDLCRRLGVQRGQMREDGRVSVDFCSCTGLCDQGPSLLINHHQVVTRLDAGRVAQLAE
FT                   FIESRVPAAQWPAHWFRVDDHVRRADVLLGTPLIPGAAIAAALARGVPALFDEMNRSNL
FT                   RGRGGAGFVTGMKWRLCRDAPGTEHYIVCNADEGEPGTFKDRVLLTRHPDMVVEGMTIG
FT                   ALAIGARRGMLYLRGEYRYLLEPLLDVLQRRREAHLLGASILGHAGFDFDIDIHVGAGA
FT                   YVCGEESALIESLEGKRGTPRIRPPFPAEHGYLQQPTVVDNVETLCAATHVALQGGAWW
FT                   SAIGTPKSTGTSLHSVSGDCERPGIYEYPLGTSVDRILEDCGARDTQAVQVGGPSGKCL
FT                   SAIEFGHRIAFEDVPSAGAFMVFDRSRDMFEVARNYAGFFAEESCGFCTPCRVGTALVV
FT                   KSMDKLAAGRGSRHDVELLSDIDILMHGTTHCGLGGSACNALHDTIVKFRPAYERRLKS
FT                   LEFEPAFDLDAEIEAARRVTGRDDDTVTQRESAA"
     gtggctgtcg aacccgatct tcagttgagc cccggacctg ccagtctgaa atccgggtcg        60
     gtcgacgctt tactgttgcg cgcgaggcat gatcctcatg cgctggtcca gatccttcgc       120
     gaggcgcagg cgcggcacac ctggctgtca cgcgaactgc tgggctatat cgccggcgcg       180
     ctcggcctga ctctcgcgca tgtggaaggc gtcgcaacgt tctatcgctt tttccatacg       240
     agccccgccg gcgagtatcg cgtgctgttc agcgacaaca tcaccgaccg catgcagggt       300
     aacgcggcct tgctggatga cctctgccga cgccttggcg tccagcgcgg gcagatgcgc       360
     gaggatggca gagtcagcgt cgatttctgt tcctgcacgg gcctctgcga tcaggggccg       420
     tccttgctga tcaatcatca tcaggtcgtc acccggctcg acgccgggcg cgtcgcgcag       480
     cttgccgaat tcattgaatc gcgggtgccg gcagcgcaat ggccggcgca ctggttccga       540
     gtggacgatc acgtgcggcg cgccgatgtc ctgctcggca cgccgctgat accgggtgcc       600
     gcgattgcgg ctgcgctggc acgcggcgtg ccggcgctgt tcgatgagat gaaccgctcc       660
     aacctgcgcg ggcgtggcgg cgccggcttc gtcaccggca tgaaatggcg gctctgccgc       720
     gacgcgccag gcaccgaaca ctacatcgtg tgcaacgcgg acgaaggcga accgggcacg       780
     ttcaaggacc gcgtattgct gacccgccac cccgacatgg tggtcgaagg gatgacgatc       840
     ggcgcgctgg cgatcggcgc gcggcgcggc atgctgtatt tacgcggcga ataccgctac       900
     ctgcttgagc cgctgctcga cgtgctgcag cgccgtcgcg aagcgcactt gctgggggct       960
     tcgattctgg gccacgcagg cttcgatttc gacatcgata tccacgtcgg cgccggggcc      1020
     tatgtgtgcg gcgaggagtc ggcgctgatc gaatcgctgg aaggcaagcg cggcacgccg      1080
     cgcatccggc cgccgtttcc cgcggaacac ggctatctgc aacagccgac cgtggtggat      1140
     aacgtcgaaa ccctgtgcgc cgccacgcac gtcgcgttgc aaggcggtgc gtggtggtcg      1200
     gccattggca cgccgaaatc caccggcacc agcctccatt cggtttcggg agactgcgag      1260
     cggccgggca tctacgaata tccgctgggc accagcgtag accggatcct cgaagattgc      1320
     ggcgcgcgcg acacgcaggc ggtgcaggtc ggcgggccgt ccgggaagtg cctgtcggcg      1380
     atcgaatttg gccaccggat tgcgttcgaa gacgtgccat cggcgggggc cttcatggta      1440
     ttcgaccgct cacgcgacat gttcgaggtg gcgcgcaact atgccggttt cttcgccgaa      1500
     gaaagttgcg ggttctgcac gccgtgccgg gtcggtaccg cgctggtagt gaaaagcatg      1560
     gacaagctcg ccgccggccg gggctcgcgt cacgacgtcg agctgctgtc ggacatcgat      1620
     atcctgatgc acggcaccac gcattgcggc ttgggcggct cggcttgcaa cgcgctgcac      1680
     gacaccatcg tgaagttccg gcccgcgtac gaacggcgtc tgaagtcgct ggaattcgag      1740
     cctgcattcg atctggacgc cgagatagag gcggcacgcc gtgtgaccgg gcgggacgac      1800
     gacacggtca cgcaacggga gagcgcagca tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page